Details of Protein
General Information of Protein (ID: PRT01474) | |||||
---|---|---|---|---|---|
Name | Lipoprotein (ESAJ) | ||||
Gene Name | esaJ | Gene ID | |||
UniProt ID | |||||
Family | Lipoprotein (LipP) | ||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
Sequence |
MKIIPWILIFGLLPLLSGCKSELYSKLDEKEANQMMALLIYNNIPADKRVEKEGVTLLVE
RERFVDAVEVLRQNGLPRRKTVTMQELFPSGQLVTSPEQEEAKLNYLKSQQIEKMLGSMD GVINAEVSVAEPRVIVGEAPPQASAAVFIKYSPEINLPAREAEIRALIHNGIPGLAPDRI SVTLQRAEYRYQPPTIAAAEDHKITLYGHPLPREALVAAACTLLFGLLISLFLWLRRPGR STS |
||||
Regulatory Network | |||||
Full List of Metabolite(s) Regulating This Protein | ||||||
---|---|---|---|---|---|---|
Organic acids and derivatives | ||||||
Alanine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
Detailed Information |
Metabo Info
![]() |
|||||
Regulating Pair |
Experim Info
![]() |
[1] | ||||
Introduced Variation | Alanine addition (24 hours) | |||||
Induced Change | ESAJ protein abundance levels: increase (FC = 4.18) | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Healthy individual | |||||
Details | It is reported that alanine addition causes the increase of ESAJ protein abundance compared with control group. | |||||
References | |||||
---|---|---|---|---|---|
1 | Alanine Enhances Aminoglycosides-Induced ROS Production as Revealed by Proteomic Analysis. Front Microbiol. 2018 Jan 30;9:29. |
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.