Details of Protein
General Information of Protein (ID: PRT01432) | |||||
---|---|---|---|---|---|
Name | Endoribonuclease LACTB2 (LACTB2) | ||||
Synonyms |
Click to Show/Hide Synonyms of This Protein
Beta-lactamase-like protein 2
|
||||
Gene Name | LACTB2 | Gene ID | |||
UniProt ID | |||||
Family | Hydrolases (EC 3) | ||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
Sequence |
MAAVLQRVERLSNRVVRVLGCNPGPMTLQGTNTYLVGTGPRRILIDTGEPAIPEYISCLK
QALTEFNTAIQEIVVTHWHRDHSGGIGDICKSINNDTTYCIKKLPRNPQREEIIGNGEQQ YVYLKDGDVIKTEGATLRVLYTPGHTDDHMALLLEEENAIFSGDCILGEGTTVFEDLYDY MNSLKELLKIKADIIYPGHGPVIHNAEAKIQQYISHRNIREQQILTLFRENFEKSFTVME LVKIIYKNTPENLHEMAKHNLLLHLKKLEKEGKIFSNTDPDKKWKAHL |
||||
Structure | |||||
Function | Endoribonuclease; cleaves preferentially 3' to purine-pyrimidine dinucleotide motifs in single-stranded RNA. The cleavage product contains a free 3' -OH group. Has no activity with double-stranded RNA or DNA. Required for normal mitochondrial function and cell viability. | ||||
Regulatory Network | |||||
Full List of Metabolite(s) Regulating This Protein | ||||||
---|---|---|---|---|---|---|
Organic acids and derivatives | ||||||
Glutamine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
Detailed Information |
Metabo Info
![]() |
|||||
Regulating Pair |
Experim Info
![]() |
[1] | ||||
Introduced Variation | Glutamine absence (16 hours) | |||||
Induced Change | LACTB2 protein abundance levels: decrease (FC = 0.71) | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Hepatocellular carcinoma [ICD-11: 2C12] | |||||
Details | It is reported that glutamine absence causes the decrease of LACTB2 protein abundance compared with control group. | |||||
References | |||||
---|---|---|---|---|---|
1 | Quantitative proteomics analysis reveals glutamine deprivation activates fatty acid -oxidation pathway in HepG2 cells. Amino Acids. 2016 May;48(5):1297-307. |
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.