Details of Protein
| General Information of Protein (ID: PRT01408) | |||||
|---|---|---|---|---|---|
| Name | Protein HflC (HFLC) | ||||
| Gene Name | hflC | Gene ID | |||
| UniProt ID | |||||
| Family | Hydrolases (EC 3) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
| Sequence |
MRKSLLVILIVVLVALYASLFVVQEGQRGIVLRFGKVLRDDENKPLVYAPGLHLKIPFIE
SVKTLDARIQTMDNQADRFVTKEKKDLIVDSYIKWRISDFSRYYLATGGGDVSQAEVLLK RKFSDRLRSEIGRLDIKDIVTDSRGKLMEDVRNALNTGTVDDAAAPTEADDAIASAAARV ARETNGKQPAVNPNSMAALGIQVVDVRIKQINLPTEVSDAIYQRMRAEREAVARRHRSQG QEEAEKLRATADYEVTRTLAGAEREGRIIRGEGDAEAAKLFANAFSKDPDFFAFIRSLKA YENSFKGGQDVMVLRPDSDFFKYMRSPDGGKSAK |
||||
| Function | HflC and HflK could regulate a protease. | ||||
| Regulatory Network | |||||
| Full List of Metabolite(s) Regulating This Protein | ||||||
|---|---|---|---|---|---|---|
| Organic acids and derivatives | ||||||
| Alanine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Alanine addition (24 hours) | |||||
| Induced Change | HFLC protein abundance levels: increase (FC = 1.97) | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Healthy individual | |||||
| Details | It is reported that alanine addition causes the increase of HFLC protein abundance compared with control group. | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | Alanine Enhances Aminoglycosides-Induced ROS Production as Revealed by Proteomic Analysis. Front Microbiol. 2018 Jan 30;9:29. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.

