Details of Protein
General Information of Protein (ID: PRT01408) | |||||
---|---|---|---|---|---|
Name | Protein HflC (HFLC) | ||||
Gene Name | hflC | Gene ID | |||
UniProt ID | |||||
Family | Hydrolases (EC 3) | ||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
Sequence |
MRKSLLVILIVVLVALYASLFVVQEGQRGIVLRFGKVLRDDENKPLVYAPGLHLKIPFIE
SVKTLDARIQTMDNQADRFVTKEKKDLIVDSYIKWRISDFSRYYLATGGGDVSQAEVLLK RKFSDRLRSEIGRLDIKDIVTDSRGKLMEDVRNALNTGTVDDAAAPTEADDAIASAAARV ARETNGKQPAVNPNSMAALGIQVVDVRIKQINLPTEVSDAIYQRMRAEREAVARRHRSQG QEEAEKLRATADYEVTRTLAGAEREGRIIRGEGDAEAAKLFANAFSKDPDFFAFIRSLKA YENSFKGGQDVMVLRPDSDFFKYMRSPDGGKSAK |
||||
Function | HflC and HflK could regulate a protease. | ||||
Regulatory Network | |||||
Full List of Metabolite(s) Regulating This Protein | ||||||
---|---|---|---|---|---|---|
Organic acids and derivatives | ||||||
Alanine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
Detailed Information |
Metabo Info
![]() |
|||||
Regulating Pair |
Experim Info
![]() |
[1] | ||||
Introduced Variation | Alanine addition (24 hours) | |||||
Induced Change | HFLC protein abundance levels: increase (FC = 1.97) | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Healthy individual | |||||
Details | It is reported that alanine addition causes the increase of HFLC protein abundance compared with control group. | |||||
References | |||||
---|---|---|---|---|---|
1 | Alanine Enhances Aminoglycosides-Induced ROS Production as Revealed by Proteomic Analysis. Front Microbiol. 2018 Jan 30;9:29. |
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.