Details of Protein
General Information of Protein (ID: PRT01401) | |||||
---|---|---|---|---|---|
Name | Agouti-related protein (AGRP) | ||||
Gene Name | Agrp | Gene ID | |||
UniProt ID | |||||
Family | Agouti protein (AGP) | ||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
Sequence |
MLTAMLLSCVLLLALPPTLGVHMGVAPLKGIRRSDQALFPEFSGLSLKKTAADRAEDVLL
QKAEALAEVLDPQNRESRSPRRCVRLHESCLGQQVPCCDLCATCYCRFFNTFCYCRKLGT GTTNLCSRP |
||||
Regulatory Network | |||||
Full List of Metabolite(s) Regulating This Protein | ||||||
---|---|---|---|---|---|---|
Organic acids and derivatives | ||||||
Leucine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
Detailed Information |
Metabo Info
![]() |
|||||
Regulating Pair |
Experim Info
![]() |
[1] | ||||
Introduced Variation | Leucine addition (504 hours) | |||||
Induced Change | AGRP mRNA levels: decrease | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Stomach cancer [ICD-11: 2B72] | |||||
Details | It is reported that leucine addition causes the decrease of AGRP mRNA levels compared with control group. | |||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.