Details of Protein
| General Information of Protein (ID: PRT01401) | |||||
|---|---|---|---|---|---|
| Name | Agouti-related protein (AGRP) | ||||
| Gene Name | Agrp | Gene ID | |||
| UniProt ID | |||||
| Family | Agouti protein (AGP) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
| Sequence |
MLTAMLLSCVLLLALPPTLGVHMGVAPLKGIRRSDQALFPEFSGLSLKKTAADRAEDVLL
QKAEALAEVLDPQNRESRSPRRCVRLHESCLGQQVPCCDLCATCYCRFFNTFCYCRKLGT GTTNLCSRP |
||||
| Regulatory Network | |||||
| Full List of Metabolite(s) Regulating This Protein | ||||||
|---|---|---|---|---|---|---|
| Organic acids and derivatives | ||||||
| Leucine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Leucine addition (504 hours) | |||||
| Induced Change | AGRP mRNA levels: decrease | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Stomach cancer [ICD-11: 2B72] | |||||
| Details | It is reported that leucine addition causes the decrease of AGRP mRNA levels compared with control group. | |||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.

