Details of Protein

General Information of Protein (ID: PRT01401)
Name Agouti-related protein (AGRP)
Gene Name Agrp Gene ID
25582
UniProt ID
F1MAG1
Family Agouti protein (AGP)
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MLTAMLLSCVLLLALPPTLGVHMGVAPLKGIRRSDQALFPEFSGLSLKKTAADRAEDVLL
QKAEALAEVLDPQNRESRSPRRCVRLHESCLGQQVPCCDLCATCYCRFFNTFCYCRKLGT
GTTNLCSRP
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Organic acids and derivatives
            Leucine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Leucine addition (504 hours)
                      Induced Change AGRP mRNA levels: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Stomach cancer [ICD-11: 2B72]
                      Details It is reported that leucine addition causes the decrease of AGRP mRNA levels compared with control group.
References
1 Dietary l-leucine supplementation of lactating rats results in a tendency to increase lean/fat ratio associated to lower orexigenic neuropeptide expression in hypothalamus. Peptides. 2010 Jul;31(7):1361-7.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.