Details of Protein
General Information of Protein (ID: PRT01390) | |||||
---|---|---|---|---|---|
Name | ADP-forming succinate--CoA ligase beta (SUCC) | ||||
Synonyms |
Click to Show/Hide Synonyms of This Protein
Succinyl-CoA synthetase subunit beta; Succinate--CoA ligase [ADP-forming] subunit beta
|
||||
Gene Name | sucC | Gene ID | |||
UniProt ID | |||||
Family | Ligases (EC 6) | ||||
EC Number | EC: 6.2.1.5 (Click to Show/Hide the Complete EC Tree) | ||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
Sequence |
MNLHEYQAKQLFARYGLPTPVGYACSTPRQAEEAASKIGSGPWVVKCQVHAGGRGKAGGV
KCVESKEAIRAFAEQWLGKRLVTYQTDAQGQPVRQILVEGATEIARELYLGAVIDRSSRR VVFMASTEGGVEIEQVAQKTPHLIHRVALDPLTGPQPYQGRELAFKLGLSGKQAQQFGQI FMGLATLFLQCDLTMAEINPLVITPQGDLLCLDGKLDVDSNALFRQPALREMEDPEQNDA REAHAAQWELNYVALEGNIGCMVNGAGLAMGTMDIVKLHGGAPANFLDVGGGATKERVTE AFKIILSDEHVRAVLVNIFGGIVRCDLIADGIIGAVAEVGVHVPVVVRLEGNNAELGTRI LADSGLNIIAATSLTDAARQVVSAVEGK |
||||
Function | Succinyl-CoA synthetase functions in the citric acid cycle (TCA), coupling the hydrolysis of succinyl-CoA to the synthesis of either ATP or GTP and thus represents the only step of substrate-level phosphorylation in the TCA. The beta subunit provides nucleotide specificity of the enzyme and binds the substrate succinate, while the binding sites for coenzyme A and phosphate are found in the alpha subunit. | ||||
Regulatory Network | |||||
Full List of Metabolite(s) Regulating This Protein | ||||||
---|---|---|---|---|---|---|
Organic acids and derivatives | ||||||
Alanine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
Detailed Information |
Metabo Info
![]() |
|||||
Regulating Pair |
Experim Info
![]() |
[1] | ||||
Introduced Variation | Alanine addition (24 hours) | |||||
Induced Change | SUCC protein abundance levels: increase (FC = 7.02) | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Healthy individual | |||||
Details | It is reported that alanine addition causes the increase of SUCC protein abundance compared with control group. | |||||
References | |||||
---|---|---|---|---|---|
1 | Alanine Enhances Aminoglycosides-Induced ROS Production as Revealed by Proteomic Analysis. Front Microbiol. 2018 Jan 30;9:29. |
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.