Details of Protein
| General Information of Protein (ID: PRT01384) | |||||
|---|---|---|---|---|---|
| Name | L-threonine dehydratase (ILVA) | ||||
| Synonyms |
Click to Show/Hide Synonyms of This Protein
Threonine deaminase
|
||||
| Gene Name | ilvA | Gene ID | |||
| UniProt ID | |||||
| Family | Lyases (EC 4) | ||||
| EC Number | EC: 4.3.1.19 (Click to Show/Hide the Complete EC Tree) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
| Sequence |
MTSKPLISSAPDGAEYLRAVLRSPVYEVAQVTPLQAMEKLSGRLGNHILVKREDRQPVHS
FKLRGAYAMIAGLSEAQRACGVITASAGNHAQGVALSASRLGIAATIVMPRATAEIKVEA VRGFGGRVLLYGANFDEAKAHAIQMAQETGMTFIPPFDHPAVIAGQGTLALELLQQDAHL DRIFVPVGGGGLAAGVAVLIKQLMPQVKVIGVEAEDSACLRAALDAGQPVDLPRVGLFAE GVAVKRIGDETFRLCQRYLDDVITVDSDAICAAVKDLFEDVRAVAEPSGALALAGLKQYV QRHALRGERLAHVLSGANLNFHGLRYVSERCELGEQREALLAVTIPERKGSFLAFCQLLG GRSVTEFNYRYADADSACIFVGVRLTNGRGEREEIIASLRGGGYQVVDLSDDEMAKLHVR YMVGGRPSKPLQERLYSFEFPEAPGALLKFLHTLGTHWNISLFHYRSHGTDFGRVLAAFE RPDSDASFEARLKELGYECHDETGNPAFRFFLQG |
||||
| Function | Catalyzes the anaerobic formation of alpha-ketobutyrate and ammonia from threonine in a two-step reaction. The first step involved a dehydration of threonine and a production of enamine intermediates (aminocrotonate), which tautomerizes to its imine form (iminobutyrate). Both intermediates are unstable and short-lived. The second step is the nonenzymatic hydrolysis of the enamine/imine intermediates to form 2-ketobutyrate and free ammonia. In the low water environment of the cell, the second step is accelerated by RidA. | ||||
| Regulatory Network | |||||
| Full List of Metabolite(s) Regulating This Protein | ||||||
|---|---|---|---|---|---|---|
| Organic acids and derivatives | ||||||
| Alanine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
 click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Alanine addition (24 hours) | |||||
| Induced Change | ILVA protein abundance levels: increase (FC = 2.2) | |||||
| Summary | Introduced Variation
Induced Change
|
|||||
| Disease Status | Healthy individual | |||||
| Details | It is reported that alanine addition causes the increase of ILVA protein abundance compared with control group. | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | Alanine Enhances Aminoglycosides-Induced ROS Production as Revealed by Proteomic Analysis. Front Microbiol. 2018 Jan 30;9:29. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.