Details of Protein

General Information of Protein (ID: PRT01365)
Name Protein-methionine-sulfoxide reductase MsrP (MSRP)
Gene Name msrP Gene ID
58257820
UniProt ID
D0ZFA2
Family Oxidoreductases (EC 1)
EC Number   EC: 1.8.5.-  (Click to Show/Hide the Complete EC Tree)
Oxidoreductase
Sulfur donor oxidoreductase
Quinone acceptor oxidoreductase
EC: 1.8.5.-
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MARYPTLREADVTPEDLFYQRRRVLKALGISAAALAITPSAHADLLSWFKGHDRPPAPPG
KPLEFTRPAAWQADLPLTPEDKVSGYNNFYEFGLDKADPAANAGTLRTDGWKITLDGEVA
KPMTLDMDDILRRFPLEERIYRMRCVEAWSMVIPWVGFELGQLLRQAEPTSRARYVAFTT
LYDPEQMPGQKDRFIGGGLKYPYVEGLRIDEAMHPLTLLSVGVYGKGLPPQNGAPIRLTV
PWKYGFKGIKSIVHIRLVENAPPTTWNLLAPKEYGFYANVNPQVDHPRWSQASERLIGSG
GILDVKRQPTLPFNGYADQVASLYQGMDLRKYY
Function Part of the MsrPQ system that repairs oxidized periplasmic proteins containing methionine sulfoxide residues (Met-O), using respiratory chain electrons. Thus protects these proteins from oxidative-stress damage caused by reactive species of oxygen and chlorine generated by the host defense mechanisms. MsrPQ is essential for the maintenance of envelope integrity under bleach stress, rescuing a wide series of structurally unrelated periplasmic proteins from methionine oxidation. The catalytic subunit MsrP is non-stereospecific, being able to reduce both (R-) and (S-) diastereoisomers of methionine sulfoxide.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Organic acids and derivatives
            Alanine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Alanine addition (24 hours)
                      Induced Change MSRP protein abundance levels: increase (FC = 3.11)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that alanine addition causes the increase of MSRP protein abundance compared with control group.
References
1 Alanine Enhances Aminoglycosides-Induced ROS Production as Revealed by Proteomic Analysis. Front Microbiol. 2018 Jan 30;9:29.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.