Details of Protein

General Information of Protein (ID: PRT01347)
Name Differentiation-related gene 1 protein (NDRG1)
Synonyms   Click to Show/Hide Synonyms of This Protein
N-myc downstream-regulated gene 1 protein; Protein Ndr1; Ndrg1; Ndr1; Ndrl; Tdd5
Gene Name Ndrg1 Gene ID
17988
UniProt ID
Q62433
Family Nmyc downstream regulated gene (NDRG)
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MSRELHDVDLAEVKPLVEKGESITGLLQEFDVQEQDIETLHGSLHVTLCGTPKGNRPVIL
TYHDIGMNHKTCYNPLFNSEDMQEITQHFAVCHVDAPGQQDGAPSFPVGYMYPSMDQLAE
MLPGVLHQFGLKSVIGMGTGAGAYILTRFALNNPEMVEGLVLMNVNPCAEGWMDWAASKI
SGWTQALPDMVVSHLFGKEEIHNNVEVVHTYRQHILNDMNPSNLHLFISAYNSRRDLEIE
RPMPGTHTVTLQCPALLVVGDNSPAVDAVVECNSKLDPTKTTLLKMADCGGLPQISQPAK
LAEAFKYFVQGMGYMPSASMTRLMRSRTASGSSVTSLEGTRSRSHTSEGPRSRSHTSEGS
RSRSHTSEDARLNITPNSGATGNNAGPKSMEVSC
Function Stress-responsive protein involved in hormone responses, cell growth, and differentiation. Acts as a tumor suppressor in many cell types. Necessary but not sufficient for p53/TP53-mediated caspase activation and apoptosis. Required for vesicular recycling of CDH1 and TF. May also function in lipid trafficking. Protects cells from spindle disruption damage. Functions in p53/TP53-dependent mitotic spindle checkpoint. Regulates microtubule dynamics and maintains euploidy. Has a role in cell trafficking notably of the Schwann cell and is necessary for the maintenance and development of the peripheral nerve myelin sheath.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Organic oxygen compounds
            Glucose Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Glucose (low concentration) addition (17.50 hours)
                      Induced Change NDRG1 protein abundance levels: increase (FC = 2.62)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Cerebral stroke [ICD-11: 8B11]
                      Details It is reported that low glucose addition causes the increase of NDRG1 protein abundance compared with control group.
References
1 Quantitative Proteomics Reveals the Beneficial Effects of Low Glucose on Neuronal Cell Survival in an in vitro Ischemic Penumbral Model. Front Cell Neurosci. 2020 Sep 1;14:272.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.