Details of Protein
| General Information of Protein (ID: PRT01334) | |||||
|---|---|---|---|---|---|
| Name | Lymphocyte activation antigen 4F2 (SLC3A2) | ||||
| Synonyms |
Click to Show/Hide Synonyms of This Protein
4F2hc; 4F2 heavy chain antigen; Lymphocyte activation antigen 4F2 large subunit; Solute carrier family 3 member 2; CD antigen CD98; SLC3A2; MDU1
|
||||
| Gene Name | SLC3A2 | Gene ID | |||
| UniProt ID | |||||
| Family | Amino acid/polyamine transporter (AAPT) | ||||
| TC Number | TC: 2.A.3.8.18 (Click to Show/Hide the Complete TC Tree) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
| Sequence |
MELQPPEASIAVVSIPRQLPGSHSEAGVQGLSAGDDSELGSHCVAQTGLELLASGDPLPS
ASQNAEMIETGSDCVTQAGLQLLASSDPPALASKNAEVTGTMSQDTEVDMKEVELNELEP EKQPMNAASGAAMSLAGAEKNGLVKIKVAEDEAEAAAAAKFTGLSKEELLKVAGSPGWVR TRWALLLLFWLGWLGMLAGAVVIIVRAPRCRELPAQKWWHTGALYRIGDLQAFQGHGAGN LAGLKGRLDYLSSLKVKGLVLGPIHKNQKDDVAQTDLLQIDPNFGSKEDFDSLLQSAKKK SIRVILDLTPNYRGENSWFSTQVDTVATKVKDALEFWLQAGVDGFQVRDIENLKDASSFL AEWQNITKGFSEDRLLIAGTNSSDLQQILSLLESNKDLLLTSSYLSDSGSTGEHTKSLVT QYLNATGNRWCSWSLSQARLLTSFLPAQLLRLYQLMLFTLPGTPVFSYGDEIGLDAAALP GQPMEAPVMLWDESSFPDIPGAVSANMTVKGQSEDPGSLLSLFRRLSDQRSKERSLLHGD FHAFSAGPGLFSYIRHWDQNERFLVVLNFGDVGLSAGLQASDLPASASLPAKADLLLSTQ PGREEGSPLELERLKLEPHEGLLLRFPYAA |
||||
| Structure | |||||
| Function | Component of several heterodimeric amino acid transporter complexes. The precise substrate specificity depends on the other subunit in the heterodimer. The heterodimer with SLC3A2 functions as sodium-independent, high-affinity transporter that mediates uptake of large neutral amino acids such as phenylalanine, tyrosine, L-DOPA, leucine, histidine, methionine and tryptophan. The complexes with SLC7A6 and SLC7A7 mediate uptake of dibasic amino acids. The complexes function as amino acid exchangers. Required for targeting of SLC7A5 and SLC7A8 to the plasma membrane and for channel activity. Plays a role in nitric oxide synthesis in human umbilical vein endothelial cells (HUVECs) via transport of L-arginine. The heterodimer with SLC7A5/LAT1 may play a role in the transport of L-DOPA across the blood-brain barrier. May mediate blood-to-retina L-leucine transport across the inner blood-retinal barrier. The heterodimer with SLC7A5/LAT1 can mediate the transport of thyroid hormones triiodothyronine (T3) and thyroxine (T4) across the cell membrane. When associated with SLC7A5 or SLC7A8, involved in the cellular activity of small molecular weight nitrosothiols, via the stereoselective transport of L-nitrosocysteine (L-CNSO) across the transmembrane. The heterodimer with SLC7A5 is involved in the uptake of toxic methylmercury (MeHg) when administered as the L-cysteine or D,L-homocysteine complexes. Together with ICAM1, regulates the transport activity SLC7A8 in polarized intestinal cells, by generating and delivering intracellular signals. When associated with LAPTM4B, the heterodimer formed by SLC3A2 and SLC7A5 is recruited to lysosomes to promote leucine uptake into these organelles, and thereby mediates mTORC1 activation. | ||||
| Regulatory Network | |||||
| Full List of Metabolite(s) Regulated by This Protein | ||||||
|---|---|---|---|---|---|---|
| Organic acids and derivatives | ||||||
| Arginine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Overexpression of SLC3A2 | |||||
| Induced Change | Arginine concentration: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Healthy individual | |||||
| Details | It is reported that overexpression of SLC3A2 and SLC7A8 leads to the increase of arginine levels compared with control group. | |||||
| Glutamine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Overexpression of SLC3A2 | |||||
| Induced Change | Glutamine concentration: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Healthy individual | |||||
| Details | It is reported that overexpression of SLC3A2 and SLC7A8 leads to the increase of glutamine levels compared with control group. | |||||
| Isoleucine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Overexpression of SLC3A2 | |||||
| Induced Change | Isoleucine concentration: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Healthy individual | |||||
| Details | It is reported that overexpression of SLC3A2 and SLC7A8 leads to the increase of isoleucine levels compared with control group. | |||||
| Leucine | Click to Show/Hide the Full List of Regulating Pair(s): 7 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair (1) |
Experim Info
click to show the details of experiment for validating this pair
|
[1], [2] | ||||
| Introduced Variation | Overexpression of SLC3A2 | |||||
| Induced Change | Leucine concentration: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Healthy individual | |||||
| Details | It is reported that overexpression of SLC3A2 and SLC7A8 leads to the increase of leucine levels compared with control group. | |||||
| Regulating Pair (2) |
Experim Info
click to show the details of experiment for validating this pair
|
[3] | ||||
| Introduced Variation | Mutation (extracellular domain residues 235-631) of SLC3A2 | |||||
| Induced Change | Leucine concentration: decrease (FC = 0.10) | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Healthy individual | |||||
| Details | It is reported that mutation (extracellular domain residues 235-631) of SLC3A2 leads to the decrease of leucine levels compared with control group. | |||||
| Regulating Pair (3) |
Experim Info
click to show the details of experiment for validating this pair
|
[3] | ||||
| Introduced Variation | Mutation (K533E) of SLC3A2 | |||||
| Induced Change | Leucine concentration: decrease (FC = 0.65) | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Healthy individual | |||||
| Details | It is reported that mutation (K533E) of SLC3A2 leads to the decrease of leucine levels compared with control group. | |||||
| Regulating Pair (4) |
Experim Info
click to show the details of experiment for validating this pair
|
[3] | ||||
| Introduced Variation | Mutation (R183A) of SLC3A2 | |||||
| Induced Change | Leucine concentration: decrease | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Healthy individual | |||||
| Details | It is reported that mutation (R183A) of SLC3A2 leads to the decrease of leucine levels compared with control group. | |||||
| Regulating Pair (5) |
Experim Info
click to show the details of experiment for validating this pair
|
[3] | ||||
| Introduced Variation | Mutation (R183E) of SLC3A2 | |||||
| Induced Change | Leucine concentration: decrease | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Healthy individual | |||||
| Details | It is reported that mutation (R183E) of SLC3A2 leads to the decrease of leucine levels compared with control group. | |||||
| Regulating Pair (6) |
Experim Info
click to show the details of experiment for validating this pair
|
[3] | ||||
| Introduced Variation | Mutation (R183K) of SLC3A2 | |||||
| Induced Change | Leucine concentration: decrease | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Healthy individual | |||||
| Details | It is reported that mutation (R183K) of SLC3A2 leads to the decrease of leucine levels compared with control group. | |||||
| Regulating Pair (7) |
Experim Info
click to show the details of experiment for validating this pair
|
[3] | ||||
| Introduced Variation | Mutation (R183L) of SLC3A2 | |||||
| Induced Change | Leucine concentration: decrease | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Healthy individual | |||||
| Details | It is reported that mutation (R183L) of SLC3A2 leads to the decrease of leucine levels compared with control group. | |||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.

