Details of Protein
| General Information of Protein (ID: PRT01304) | |||||
|---|---|---|---|---|---|
| Name | Moesin (MSN) | ||||
| Synonyms |
Click to Show/Hide Synonyms of This Protein
Membrane-organizing extension spike protein; MSN
|
||||
| Gene Name | MSN | Gene ID | |||
| UniProt ID | |||||
| Family | Ezrin-radixin-moesin (ERM) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
| Sequence |
MPKTISVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWFFGLQYQDTKGFSTWLK
LNKKVTAQDVRKESPLLFKFRAKFYPEDVSEELIQDITQRLFFLQVKEGILNDDIYCPPE TAVLLASYAVQSKYGDFNKEVHKSGYLAGDKLLPQRVLEQHKLNKDQWEERIQVWHEEHR GMLREDAVLEYLKIAQDLEMYGVNYFSIKNKKGSELWLGVDALGLNIYEQNDRLTPKIGF PWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKPDTI EVQQMKAQAREEKHQKQMERAMLENEKKKREMAEKEKEKIEREKEELMERLKQIEEQTKK AQQELEEQTRRALELEQERKRAQSEAEKLAKERQEAEEAKEALLQASRDQKKTQEQLALE MAELTARISQLEMARQKKESEAVEWQQKAQMVQEDLEKTRAELKTAMSTPHVAEPAENEQ DEQDENGAEASADLRADAMAKDRSEEERTTEAEKNERVQKHLKALTSELANARDESKKTA NDMIHAENMRLGRDKYKTLRQIRQGNTKQRIDEFESM |
||||
| Structure | |||||
| Function | Ezrin-radixin-moesin (ERM) family protein that connects the actin cytoskeleton to the plasma membrane and thereby regulates the structure and function of specific domains of the cell cortex. Tethers actin filaments by oscillating between a resting and an activated state providing transient interactions between moesin and the actin cytoskeleton. Once phosphorylated on its C-terminal threonine, moesin is activated leading to interaction with F-actin and cytoskeletal rearrangement. These rearrangements regulate many cellular processes, including cell shape determination, membrane transport, and signal transduction. The role of moesin is particularly important in immunity acting on both T and B-cells homeostasis and self-tolerance, regulating lymphocyte egress from lymphoid organs. Modulates phagolysosomal biogenesis in macrophages. Participates also in immunologic synapse formation. | ||||
| Regulatory Network | |||||
| Full List of Metabolite(s) Regulating This Protein | ||||||
|---|---|---|---|---|---|---|
| Organic oxygen compounds | ||||||
| Mannitol | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
 click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Mannitol addition (16 hours) | |||||
| Induced Change | MSN protein expression levels: increase | |||||
| Summary | Introduced Variation
Induced Change
|
|||||
| Disease Status | Hyperglycemic hyperosmolar syndrome [ICD-11: 5A20] | |||||
| Details | It is reported that mannitol addition causes the increase of MSN protein expression compared with control group. | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | High-glucose-induced changes in macrophage secretome: regulation of immune response. Mol Cell Biochem. 2019 Feb;452(1-2):51-62. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.