Details of Protein

General Information of Protein (ID: PRT01298)
Name Transmembrane emp24 domain-containing 7 (TMED7)
Synonyms   Click to Show/Hide Synonyms of This Protein
p24 family protein gamma-3; p24gamma3; p27; CGI-109; TMED7
Gene Name TMED7 Gene ID
100302736
UniProt ID
Q9Y3B3
Family Transmembrane Emp24 domain-containing protein (TMED)
TC Number   TC: 9.B.188.1.8  (Click to Show/Hide the Complete TC Tree)
The Transmembrane Emp24 Domain-containing Protein (TMED) Family
.
TC: 9.B.188.1.8
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MPRPGSAQRWAAVAGRWGCRLLALLLLVPGPGGASEITFELPDNAKQCFYEDIAQGTKCT
LEFQVITGGHYDVDCRLEDPDGKVLYKEMKKQYDSFTFTASKNGTYKFCFSNEFSTFTHK
TVYFDFQVGEDPPLFPSENRVSALTQMESACVSIHEALKSVIDYQTHFRLREAQGRSRAE
DLNTRVAYWSVGEALILLVVSIGQVFLLKSFFSDKRTTTTRVGS
Function Potential role in vesicular protein trafficking, mainly in the early secretory pathway. Appears to play a role in the biosynthesis of secreted cargo including processing and post-translational modifications.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Organic acids and derivatives
            Glutamine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Glutamine absence (16 hours)
                      Induced Change TMED7 protein abundance levels: increase (FC = 1.54)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Hepatocellular carcinoma [ICD-11: 2C12]
                      Details It is reported that glutamine absence causes the increase of TMED7 protein abundance compared with control group.
References
1 Quantitative proteomics analysis reveals glutamine deprivation activates fatty acid -oxidation pathway in HepG2 cells. Amino Acids. 2016 May;48(5):1297-307.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.