Details of Protein
General Information of Protein (ID: PRT01268) | |||||
---|---|---|---|---|---|
Name | NSFL1 cofactor p47 (NSFL1C) | ||||
Synonyms |
Click to Show/Hide Synonyms of This Protein
UBX domain-containing protein 2C; p97 cofactor p47; NSFL1C; UBXN2C
|
||||
Gene Name | NSFL1C | Gene ID | |||
UniProt ID | |||||
Family | UBX domain-containing protein (UDCP) | ||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
Sequence |
MAAERQEALREFVAVTGAEEDRARFFLESAGWDLQIALASFYEDGGDEDIVTISQATPSS
VSRGTAPSDNRVTSFRDLIHDQDEDEEEEEGQRFYAGGSERSGQQIVGPPRKKSPNELVD DLFKGAKEHGAVAVERVTKSPGETSKPRPFAGGGYRLGAAPEEESAYVAGEKRQHSSQDV HVVLKLWKSGFSLDNGELRSYQDPSNAQFLESIRRGEVPAELRRLAHGGQVNLDMEDHRD EDFVKPKGAFKAFTGEGQKLGSTAPQVLSTSSPAQQAENEAKASSSILIDESEPTTNIQI RLADGGRLVQKFNHSHRISDIRLFIVDARPAMAATSFILMTTFPNKELADESQTLKEANL LNAVIVQRLT |
||||
Structure | |||||
Function | Reduces the ATPase activity of VCP. Necessary for the fragmentation of Golgi stacks during mitosis and for VCP-mediated reassembly of Golgi stacks after mitosis. May play a role in VCP-mediated formation of transitional endoplasmic reticulum (tER). Inhibits the activity of CTSL (in vitro). Together with UBXN2B/p37, regulates the centrosomal levels of kinase AURKA/Aurora A during mitotic progression by promoting AURKA removal from centrosomes in prophase. Also, regulates spindle orientation during mitosis. | ||||
Regulatory Network | |||||
Full List of Metabolite(s) Regulating This Protein | ||||||
---|---|---|---|---|---|---|
Organic acids and derivatives | ||||||
Arginine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
Detailed Information |
Metabo Info
![]() |
|||||
Regulating Pair |
Experim Info
![]() |
[1] | ||||
Introduced Variation | Arginine decrease (48 hours) | |||||
Induced Change | NSFL1C protein expression levels: decrease | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Colon cancer [ICD-11: 2B90] | |||||
Details | It is reported that arginine decrease causes the decrease of NSFL1C protein expression compared with control group. | |||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.