Details of Protein

General Information of Protein (ID: PRT01233)
Name Aging-associated gene 13 (AAG13)
Synonyms   Click to Show/Hide Synonyms of This Protein
Aging-associated gene 13 protein; Protein S100-F; S100 calcium-binding protein A16; AAG13; S100A16; S100F
Gene Name S100A16 Gene ID
140576
UniProt ID
Q96FQ6
Family S100 calcium-binding protein (S100)
TC Number   TC: 8.A.81.1.3  (Click to Show/Hide the Complete TC Tree)
The S100 Calcium-binding protein (S100) Family
.
TC: 8.A.81.1.3
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MSDCYTELEKAVIVLVENFYKYVSKYSLVKNKISKSSFREMLQKELNHMLSDTGNRKAAD
KLIQNLDANHDGRISFDEYWTLIGGITGPIAKLIHEQEQQSSS
Structure
2L50 ; 2L51 ; 3NXA
Function Calcium-binding protein. Binds one calcium ion per monomer. Can promote differentiation of adipocytes (in vitro). Overexpression in preadipocytes increases their proliferation, enhances adipogenesis and reduces insulin-stimulated glucose uptake.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Organic acids and derivatives
            Glutamine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Glutamine absence (16 hours)
                      Induced Change S100A16 protein abundance levels: increase (FC = 1.39)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Hepatocellular carcinoma [ICD-11: 2C12]
                      Details It is reported that glutamine absence causes the increase of S100A16 protein abundance compared with control group.
References
1 Quantitative proteomics analysis reveals glutamine deprivation activates fatty acid -oxidation pathway in HepG2 cells. Amino Acids. 2016 May;48(5):1297-307.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.