Details of Protein

General Information of Protein (ID: PRT01224)
Name Annexin A2 (ANXA2)
Synonyms   Click to Show/Hide Synonyms of This Protein
Annexin II; Annexin-2; Calpactin I heavy chain; Calpactin-1 heavy chain; Chromobindin-8; Lipocortin II; Placental anticoagulant protein IV; PAP-IV; Protein I; p36; ANXA2; ANX2; ANX2L4; CAL1H; LPC2D
Gene Name ANXA2 Gene ID
302
UniProt ID
P07355
Family Annexin (ANEX)
TC Number   TC: 1.A.31.1.4  (Click to Show/Hide the Complete TC Tree)
The Annexin Family
.
TC: 1.A.31.1.4
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MSTVHEILCKLSLEGDHSTPPSAYGSVKAYTNFDAERDALNIETAIKTKGVDEVTIVNIL
TNRSNAQRQDIAFAYQRRTKKELASALKSALSGHLETVILGLLKTPAQYDASELKASMKG
LGTDEDSLIEIICSRTNQELQEINRVYKEMYKTDLEKDIISDTSGDFRKLMVALAKGRRA
EDGSVIDYELIDQDARDLYDAGVKRKGTDVPKWISIMTERSVPHLQKVFDRYKSYSPYDM
LESIRKEVKGDLENAFLNLVQCIQNKPLYFADRLYDSMKGKGTRDKVLIRIMVSRSEVDM
LKIRSEFKRKYGKSLYYYIQQDTKGDYQKALLYLCGGDD
Structure
1W7B ; 1XJL ; 2HYU ; 2HYV ; 2HYW ; 4DRW ; 4FTG ; 4HRH ; 5LPU ; 5LPX ; 5LQ0 ; 5LQ2 ; 5N7D ; 5N7F ; 5N7G ; 6TWQ ; 6TWU ; 6TWX ; 6TWY
Function Calcium-regulated membrane-binding protein whose affinity for calcium is greatly enhanced by anionic phospholipids. It binds two calcium ions with high affinity. May be involved in heat-stress response. Inhibits PCSK9-enhanced LDLR degradation, probably reduces PCSK9 protein levels via a translational mechanism but also competes with LDLR for binding with PCSK9.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Organic acids and derivatives
            Arginine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Arginine decrease (48 hours)
                      Induced Change ANXA2 protein abundance levels: decrease (FC = 1.7)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Colon cancer [ICD-11: 2B90]
                      Details It is reported that arginine decrease causes the decrease of ANXA2 protein abundance compared with control group.
References
1 Arginine deficiency in preconfluent intestinal Caco-2 cells modulates expression of proteins involved in proliferation, apoptosis, and heat shock response. Proteomics. 2007 Feb;7(4):565-577.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.