Details of Protein

General Information of Protein (ID: PRT01220)
Name Small ubiquitin-related modifier 1 (SUMO1)
Synonyms   Click to Show/Hide Synonyms of This Protein
SUMO-1; GAP-modifying protein 1; GMP1; SMT3 homolog 3; Sentrin; Ubiquitin-homology domain protein PIC1; Ubiquitin-like protein SMT3C; Smt3C; Ubiquitin-like protein UBL1; OK/SW-cl.43; SUMO1; SMT3C; SMT3H3; UBL1
Gene Name SUMO1 Gene ID
7341
UniProt ID
P63165
Family Small ubiquitin-related modifier (SURM)
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMN
SLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV
Structure
1A5R ; 1TGZ ; 1WYW ; 1Y8R ; 1Z5S ; 2ASQ ; 2BF8 ; 2G4D ; 2IO2 ; 2IY0 ; 2IY1 ; 2KQS ; 2LAS ; 2MW5 ; 2N1A ; 2N1V ; 2PE6 ; 2UYZ ; 2VRR ; 3KYC ; 3KYD ; 3RZW ; 3UIP ; 4WJN ; 4WJO ; 4WJP ; 4WJQ ; 5AEK ; 5B7A ; 5ELJ ; 5GHD ; 6EOP ; 6EOT ; 6J4I ; 6JXU ; 6JXV ; 6K5T ; 6UYO ; 6UYP ; 6UYQ ; 6UYR ; 6UYS ; 6UYT ; 6UYU ; 6UYV ; 6UYX ; 6UYY ; 6UYZ ; 6V7P ; 6V7Q ; 6V7R ; 6V7S ; 6WW3
Function Ubiquitin-like protein that can be covalently attached to proteins as a monomer or a lysine-linked polymer. Covalent attachment via an isopeptide bond to its substrates requires prior activation by the E1 complex SAE1-SAE2 and linkage to the E2 enzyme UBE2I, and can be promoted by E3 ligases such as PIAS1-4, RANBP2 or CBX4. This post-translational modification on lysine residues of proteins plays a crucial role in a number of cellular processes such as nuclear transport, DNA replication and repair, mitosis and signal transduction. Involved for instance in targeting RANGAP1 to the nuclear pore complex protein RANBP2. Covalently attached to the voltage-gated potassium channel KCNB1; this modulates the gating characteristics of KCNB1. Polymeric SUMO1 chains are also susceptible to polyubiquitination which functions as a signal for proteasomal degradation of modified proteins. May also regulate a network of genes involved in palate development. Covalently attached to ZFHX3.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Organic acids and derivatives
            Glutamine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Glutamine addition (12 hours)
                      Induced Change SUMO1 protein expression levels: increase (FC = 2.506)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Inflammatory bowel disease [ICD-11: DD72]
                      Details It is reported that glutamine addition causes the increase of SUMO1 protein expression compared with control group.
References
1 Proteomic analysis of glutamine-treated human intestinal epithelial HCT-8 cells under basal and inflammatory conditions. Proteomics. 2006 Jul;6(13):3926-37.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.