Details of Protein

General Information of Protein (ID: PRT01218)
Name Cold-inducible RNA-binding (CIRBP)
Synonyms   Click to Show/Hide Synonyms of This Protein
A18 hnRNP; Glycine-rich RNA-binding protein CIRP; Cirbp; Cirp
Gene Name Cirbp Gene ID
12696
UniProt ID
P60824
Family RNA recognition motif (Rnrmo)
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MASDEGKLFVGGLSFDTNEQALEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDA
KDAMMAMNGKSVDGRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRSRGRGFSRGGGD
RGYGGGRFESRSGGYGGSRDYYASRSQGGSYGYRSSGGSYRDSYDSYATHNE
Function Cold-inducible mRNA binding protein that plays a protective role in the genotoxic stress response by stabilizing transcripts of genes involved in cell survival. Promotes assembly of stress granules (SGs), when overexpressed. Seems to play an essential role in cold-induced suppression of cell proliferation. Acts as a translational repressor. Acts as a translational activator. Binds specifically to the 3'-untranslated regions (3'-UTRs) of stress-responsive transcripts RPA2 and TXN.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Organic oxygen compounds
            Glucose Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Glucose (low concentration) addition (17.50 hours)
                      Induced Change CIRBP protein abundance levels: increase (FC = 2.45)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Cerebral stroke [ICD-11: 8B11]
                      Details It is reported that low glucose addition causes the increase of CIRBP protein abundance compared with control group.
References
1 Quantitative Proteomics Reveals the Beneficial Effects of Low Glucose on Neuronal Cell Survival in an in vitro Ischemic Penumbral Model. Front Cell Neurosci. 2020 Sep 1;14:272.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.