Details of Protein
General Information of Protein (ID: PRT01203) | |||||
---|---|---|---|---|---|
Name | Trans-Golgi network integral membrane 2 (TGOLN2) | ||||
Synonyms |
Click to Show/Hide Synonyms of This Protein
Trans-Golgi network glycoprotein 46; TGN38 homolog; hTGN46; Trans-Golgi network glycoprotein 48; hTGN48; Trans-Golgi network glycoprotein 51; hTGN51; Trans-Golgi network protein 2; TGOLN2; TGN46; TGN51
|
||||
Gene Name | TGOLN2 | Gene ID | |||
UniProt ID | |||||
Family | Hydrolases (EC 3) | ||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
Sequence |
MRFVVALVLLNVAAAGAVPLLATESVKQEEAGVRPSAGNVSTHPSLSQRPGGSTKSHPEP
QTPKDSPSKSSAEAQTPEDTPNKSGAEAKTQKDSSNKSGAEAKTQKGSTSKSGSEAQTTK DSTSKSHPELQTPKDSTGKSGAEAQTPEDSPNRSGAEAKTQKDSPSKSGSEAQTTKDVPN KSGADGQTPKDGSSKSGAEDQTPKDVPNKSGAEKQTPKDGSNKSGAEEQGPIDGPSKSGA EEQTSKDSPNKVVPEQPSRKDHSKPISNPSDNKELPKADTNQLADKGKLSPHAFKTESGE ETDLISPPQEEVKSSEPTEDVEPKEAEDDDTGPEEGSPPKEEKEKMSGSASSENREGTLS DSTGSEKDDLYPNGSGNGSAESSHFFAYLVTAAILVAVLYIAHHNKRKIIAFVLEGKRSK VTRRPKASDYQRLDQKS |
||||
Structure | |||||
Function | May be involved in regulating membrane traffic to and from trans-Golgi network. | ||||
Regulatory Network | |||||
Full List of Metabolite(s) Regulating This Protein | ||||||
---|---|---|---|---|---|---|
Organic acids and derivatives | ||||||
Glutamine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
Detailed Information |
Metabo Info
![]() |
|||||
Regulating Pair |
Experim Info
![]() |
[1] | ||||
Introduced Variation | Glutamine addition (24 hours) | |||||
Induced Change | TGOLN2 protein expression levels: increase | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Colon cancer [ICD-11: 2B90] | |||||
Details | It is reported that glutamine addition causes the increase of TGOLN2 protein expression compared with control group. | |||||
References | |||||
---|---|---|---|---|---|
1 | Glutamine regulates the human epithelial intestinal HCT-8 cell proteome under apoptotic conditions. Mol Cell Proteomics. 2007 Oct;6(10):1671-9. |
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.