General Information of Protein (ID: PRT01201)
Name Cyclooxygenase-2 (COX-2)
Synonyms   Click to Show/Hide Synonyms of This Protein
Prostaglandin G/H synthase 2; COX-2; Glucocorticoid-regulated inflammatory cyclooxygenase; Gripghs; Macrophage activation-associated marker protein P71/73; PES-2; PHS II; Prostaglandin H2 synthase 2; PGH synthase 2; PGHS-2; Prostaglandin-endoperoxide synthase 2; TIS10 protein; Ptgs2; Cox-2; Cox2; Pghs-b; Tis10
Gene Name Ptgs2 Gene ID
19225
UniProt ID
Q05769
Family Oxidoreductases (EC 1)
EC Number   EC: 1.14.99.1  (Click to Show/Hide the Complete EC Tree)
Oxidoreductase
Oxygen paired donor oxidoreductase
Oxygen paired donor oxidoreductase
EC: 1.14.99.1
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MLFRAVLLCAALGLSQAANPCCSNPCQNRGECMSTGFDQYKCDCTRTGFYGENCTTPEFL
TRIKLLLKPTPNTVHYILTHFKGVWNIVNNIPFLRSLIMKYVLTSRSYLIDSPPTYNVHY
GYKSWEAFSNLSYYTRALPPVADDCPTPMGVKGNKELPDSKEVLEKVLLRREFIPDPQGS
NMMFAFFAQHFTHQFFKTDHKRGPGFTRGLGHGVDLNHIYGETLDRQHKLRLFKDGKLKY
QVIGGEVYPPTVKDTQVEMIYPPHIPENLQFAVGQEVFGLVPGLMMYATIWLREHNRVCD
ILKQEHPEWGDEQLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQQFQYQ
NRIASEFNTLYHWHPLLPDTFNIEDQEYSFKQFLYNNSILLEHGLTQFVESFTRQIAGRV
AGGRNVPIAVQAVAKASIDQSREMKYQSLNEYRKRFSLKPYTSFEELTGEKEMAAELKAL
YSDIDVMELYPALLVEKPRPDAIFGETMVELGAPFSLKGLMGNPICSPQYWKPSTFGGEV
GFKIINTASIQSLICNNVKGCPFTSFNVQDPQPTKTATINASASHSRLDDINPTVLIKRR
STEL
Structure
1CVU ; 1CX2 ; 1DCX ; 1DD0 ; 1DDX ; 1PXX ; 3HS5 ; 3HS6 ; 3HS7 ; 3KRK ; 3LN0 ; 3LN1 ; 3MDL ; 3MQE ; 3NT1 ; 3NTB ; 3NTG ; 3OLT ; 3OLU ; 3PGH ; 3Q7D ; 3QH0 ; 3QMO ; 3RR3 ; 3TZI ; 4COX ; 4E1G ; 4FM5 ; 4M10 ; 4M11 ; 4OTJ ; 4OTY ; 4PH9 ; 4RRW ; 4RRX ; 4RRY ; 4RRZ ; 4RS0 ; 4RUT ; 4Z0L ; 5COX ; 5FDQ ; 5JVY ; 5JVZ ; 5JW1 ; 5W58 ; 6BL3 ; 6BL4 ; 6COX ; 6OFY ; 6V3R
Function Dual cyclooxygenase and peroxidase in the biosynthesis pathway of prostanoids, a class of C20 oxylipins mainly derived from arachidonate, with a particular role in the inflammatory response. The cyclooxygenase activity oxygenates arachidonate (AA, C20:4(n-6)) to the hydroperoxy endoperoxide prostaglandin G2 (PGG2), and the peroxidase activity reduces PGG2 to the hydroxy endoperoxide PGH2, the precursor of all 2-series prostaglandins and thromboxanes. This complex transformation is initiated by abstraction of hydrogen at carbon 13 (with S-stereochemistry), followed by insertion of molecular O2 to form the endoperoxide bridge between carbon 9 and 11 that defines prostaglandins. The insertion of a second molecule of O2 (bis-oxygenase activity) yields a hydroperoxy group in PGG2 that is then reduced to PGH2 by two electrons. Similarly catalyzes successive cyclooxygenation and peroxidation of dihomo-gamma-linoleate (DGLA, C20:3(n-6)) and eicosapentaenoate (EPA, C20:5(n-3)) to corresponding PGH1 and PGH3, the precursors of 1- and 3-series prostaglandins. In an alternative pathway of prostanoid biosynthesis, converts 2-arachidonoyl lysophopholipids to prostanoid lysophopholipids, which are then hydrolyzed by intracellular phospholipases to release free prostanoids. Metabolizes 2-arachidonoyl glycerol yielding the glyceryl ester of PGH2, a process that can contribute to pain response. Generates lipid mediators from n-3 and n-6 polyunsaturated fatty acids (PUFAs) via a lipoxygenase-type mechanism. Oxygenates PUFAs to hydroperoxy compounds and then reduces them to corresponding alcohols. Plays a role in the generation of resolution phase interaction products (resolvins) during both sterile and infectious inflammation. Metabolizes docosahexaenoate (DHA, C22:6(n-3)) to 17R-HDHA, a precursor of the D-series resolvins (RvDs). As a component of the biosynthetic pathway of E-series resolvins (RvEs), converts eicosapentaenoate (EPA, C20:5(n-3)) primarily to 18S-HEPE that is further metabolized by ALOX5 and LTA4H to generate 18S-RvE1 and 18S-RvE2. In vascular endothelial cells, converts docosapentaenoate (DPA, C22:5(n-3)) to 13R-HDPA, a precursor for 13-series resolvins (RvTs) shown to activate macrophage phagocytosis during bacterial infection. In activated leukocytes, contributes to oxygenation of hydroxyeicosatetraenoates (HETE) to diHETES (5,15-diHETE and 5,11-diHETE). During neuroinflammation, plays a role in neuronal secretion of specialized preresolving mediators (SPMs) 15R-lipoxin A4 that regulates phagocytic microglia.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Organic oxygen compounds
            Glucose Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Glucose (low concentration) addition (17.50 hours)
                      Induced Change PTGS2 protein abundance levels: decrease (FC = 1.60)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Cerebral stroke [ICD-11: 8B11]
                      Details It is reported that low glucose addition causes the decrease of PTGS2 protein abundance compared with control group.
References
1 Quantitative Proteomics Reveals the Beneficial Effects of Low Glucose on Neuronal Cell Survival in an in vitro Ischemic Penumbral Model. Front Cell Neurosci. 2020 Sep 1;14:272.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.