Details of Protein
General Information of Protein (ID: PRT01186) | |||||
---|---|---|---|---|---|
Name | Serine/threonine PP2A-alpha (PPP2CA) | ||||
Synonyms |
Click to Show/Hide Synonyms of This Protein
PP2A-alpha; Replication protein C; RP-C; PPP2CA
|
||||
Gene Name | PPP2CA | Gene ID | |||
UniProt ID | |||||
Family | Hydrolases (EC 3) | ||||
EC Number | EC: 3.1.3.16 (Click to Show/Hide the Complete EC Tree) | ||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
Sequence |
MDEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHG
QFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHES RQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHI RALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRA HQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHV TRRTPDYFL |
||||
Structure | |||||
Function | PP2A is the major phosphatase for microtubule-associated proteins (MAPs). PP2A can modulate the activity of phosphorylase B kinase casein kinase 2, mitogen-stimulated S6 kinase, and MAP-2 kinase. Cooperates with SGO2 to protect centromeric cohesin from separase-mediated cleavage in oocytes specifically during meiosis I. Can dephosphorylate SV40 large T antigen and p53/TP53. Activates RAF1 by dephosphorylating it at 'Ser-259'. Mediates dephosphorylation of WEE1, preventing its ubiquitin-mediated proteolysis, increasing WEE1 protein levels, and promoting the G2/M checkpoint. | ||||
Regulatory Network | |||||
Full List of Metabolite(s) Regulating This Protein | ||||||
---|---|---|---|---|---|---|
Organic acids and derivatives | ||||||
Glutamine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
Detailed Information |
Metabo Info
![]() |
|||||
Regulating Pair |
Experim Info
![]() |
[1] | ||||
Introduced Variation | Glutamine absence (16 hours) | |||||
Induced Change | PPP2CA protein abundance levels: increase (FC = 1.36) | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Hepatocellular carcinoma [ICD-11: 2C12] | |||||
Details | It is reported that glutamine absence causes the increase of PPP2CA protein abundance compared with control group. | |||||
References | |||||
---|---|---|---|---|---|
1 | Quantitative proteomics analysis reveals glutamine deprivation activates fatty acid -oxidation pathway in HepG2 cells. Amino Acids. 2016 May;48(5):1297-307. |
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.