Details of Protein

General Information of Protein (ID: PRT01166)
Name Solute carrier family 38 member 2 (SLC38A2)
Synonyms   Click to Show/Hide Synonyms of This Protein
Amino acid transporter A2; Solute carrier family 38 member 2; System A amino acid transporter 2; System A transporter 1; System N amino acid transporter 2; Slc38a2; Ata2; Kiaa1382; Sat2; Snat2
Gene Name Slc38a2 Gene ID
67760
UniProt ID
Q8CFE6
Family Amino acid/polyamine transporter (AAPT)
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MKKTEMGRFNISPDEDSSSYSSNSDFNYSYPTKQAALKSHYADVDPENQNFLLESNLGKK
KYETDFHPGTTSFGMSVFNLSNAIVGSGILGLSYAMANTGIALFIILLTFVSIFSLYSVH
LLLKTANEGGSLLYEQLGHKAYGLAGKLAASGSITMQNIGAMSSYLFIVKYELPLVIKAL
MNIEDTNGLWYLNGDYLVLLVSLVLILPLSLLRNLGYLGYTSGLSLLCMIFFLIVVICKK
FQIPCPVEAALVANETVNGTFTQAALALAFNSTADDACRPRYFIFNSQTVYAVPILTFSF
VCHPAVLPIYEELKSRSRRRMMNVSKISFFAMFLMYLLAALFGYLTFYGHVESELLHTYS
EIVGTDILLLVVRLAVLVAVTLTVPVVIFPIRSSVTHLLCPTKEFSWLRHSIITVTILSF
TNLLVIFVPTIRDIFGFIGASAAAMLIFILPSAFYIKLVKKEPMRSVQKIGALCFLLSGI
VVMIGSMGLIVLDWVHDASAAGGH
Function Functions as a sodium-dependent amino acid transporter. Mediates the saturable, pH-sensitive and electrogenic cotransport of neutral amino acids and sodium ions with a stoichiometry of 1:1. May function in the transport of amino acids at the blood-brain barrier and in the supply of maternal nutrients to the fetus through the placenta.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Organic oxygen compounds
            Glucose Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Glucose (low concentration) addition (17.50 hours)
                      Induced Change SLC38A2 protein abundance levels: decrease (FC = 1.50)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Cerebral stroke [ICD-11: 8B11]
                      Details It is reported that low glucose addition causes the decrease of SLC38A2 protein abundance compared with control group.
References
1 Quantitative Proteomics Reveals the Beneficial Effects of Low Glucose on Neuronal Cell Survival in an in vitro Ischemic Penumbral Model. Front Cell Neurosci. 2020 Sep 1;14:272.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.