Details of Protein
| General Information of Protein (ID: PRT01153) | |||||
|---|---|---|---|---|---|
| Name | Solute carrier family 29 member 4 (SLC29A4) | ||||
| Synonyms |
Click to Show/Hide Synonyms of This Protein
hENT4; Plasma membrane monoamine transporter; Solute carrier family 29 member 4; PSEC0113; SLC29A4; ENT4; PMAT
|
||||
| Gene Name | SLC29A4 | Gene ID | |||
| UniProt ID | |||||
| Family | Equilibrative nucleoside transporter (ENT) | ||||
| TC Number | TC: 2.A.57.1.5 (Click to Show/Hide the Complete TC Tree) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
| Sequence |
MGSVGSQRLEEPSVAGTPDPGVVMSFTFDSHQLEEAAEAAQGQGLRARGVPAFTDTTLDE
PVPDDRYHAIYFAMLLAGVGFLLPYNSFITDVDYLHHKYPGTSIVFDMSLTYILVALAAV LLNNVLVERLTLHTRITAGYLLALGPLLFISICDVWLQLFSRDQAYAINLAAVGTVAFGC TVQQSSFYGYTGMLPKRYTQGVMTGESTAGVMISLSRILTKLLLPDERASTLIFFLVSVA LELLCFLLHLLVRRSRFVLFYTTRPRDSHRGRPGLGRGYGYRVHHDVVAGDVHFEHPAPA LAPNESPKDSPAHEVTGSGGAYMRFDVPRPRVQRSWPTFRALLLHRYVVARVIWADMLSI AVTYFITLCLFPGLESEIRHCILGEWLPILIMAVFNLSDFVGKILAALPVDWRGTHLLAC SCLRVVFIPLFILCVYPSGMPALRHPAWPCIFSLLMGISNGYFGSVPMILAAGKVSPKQR ELAGNTMTVSYMSGLTLGSAVAYCTYSLTRDAHGSCLHASTANGSILAGL |
||||
| Function | Functions as a polyspecific organic cation transporter, efficiently transporting many organic cations such as monoamine neurotransmitters 1-methyl-4-phenylpyridinium and biogenic amines including serotonin, dopamine, norepinephrine and epinephrine. May play a role in regulating central nervous system homeostasis of monoamine neurotransmitters. May be involved in luminal transport of organic cations in the kidney and seems to use luminal proton gradient to drive organic cation reabsorption. Does not seem to transport nucleoside and nucleoside analogs such as uridine, cytidine, thymidine, adenosine, inosine, guanosine, and azidothymidine. In adenosine is efficiently transported but in a fashion highly sensitive to extracellular pH, with maximal activity in the pH range 5.5 to 6.5. Glu-206 is essential for the cation selectivity and may function as the charge sensor for cationic substrates. Transport is chloride and sodium-independent but appears to be sensitive to changes in membrane potential. Weakly inhibited by the classical inhibitors of equilibrative nucleoside transport, dipyridamole, dilazep, and nitrobenzylthioinosine. May play a role in the regulation of extracellular adenosine concentrations in cardiac tissues, in particular during ischemia. | ||||
| Regulatory Network | |||||
| Full List of Metabolite(s) Regulated by This Protein | ||||||
|---|---|---|---|---|---|---|
| Benzenoids | ||||||
| Dopamine | Click to Show/Hide the Full List of Regulating Pair(s): 2 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair (1) |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Mutation (138T) of SLC29A4 | |||||
| Induced Change | Dopamine concentration: decrease | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Asperger syndrome [ICD-11: 6A02] | |||||
| Details | It is reported that mutation (138T) of SLC29A4 leads to the decrease of dopamine levels compared with control group. | |||||
| Regulating Pair (2) |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Mutation (D326E) of SLC29A4 | |||||
| Induced Change | Dopamine concentration: decrease | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Asperger syndrome [ICD-11: 6A02] | |||||
| Details | It is reported that mutation (D326E) of SLC29A4 leads to the decrease of dopamine levels compared with control group. | |||||
| Organoheterocyclic compounds | ||||||
| Thiamine | Click to Show/Hide the Full List of Regulating Pair(s): 2 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair (1) |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Mutation (138T) of SLC29A4 | |||||
| Induced Change | Thiamine concentration: decrease | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Asperger syndrome [ICD-11: 6A02] | |||||
| Details | It is reported that mutation (138T) of SLC29A4 leads to the decrease of thiamine levels compared with control group. | |||||
| Regulating Pair (2) |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Mutation (D326E) of SLC29A4 | |||||
| Induced Change | Thiamine concentration: decrease | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Asperger syndrome [ICD-11: 6A02] | |||||
| Details | It is reported that mutation (D326E) of SLC29A4 leads to the decrease of thiamine levels compared with control group. | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | Autism spectrum disorder associated with low serotonin in CSF and mutations in the SLC29A4 plasma membrane monoamine transporter (PMAT) gene. Mol Autism. 2014 Aug 13;5:43. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.

