Details of Protein

General Information of Protein (ID: PRT01137)
Name hnRNP A1 (HNRNPA1)
Synonyms   Click to Show/Hide Synonyms of This Protein
hnRNP A1; Helix-destabilizing protein; Single-strand RNA-binding protein; hnRNP core protein A1; HNRNPA1; HNRPA1
Gene Name HNRNPA1 Gene ID
3178
UniProt ID
P09651
Family Ribosomal protein (Ribo)
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFV
TYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHH
LRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKA
LSKQEMASASSSQRGRSGSGNFGGGRGGGFGGNDNFGRGGNFSGRGGFGGSRGGGGYGGS
GDGYNGFGNDGGYGGGGPGYSGGSRGYGSGGQGYGNQGSGYGGSGSYDSYNNGGGGGFGG
GSGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGYGGS
SSSSSYGSGRRF
Structure
1HA1 ; 1L3K ; 1PGZ ; 1PO6 ; 1U1K ; 1U1L ; 1U1M ; 1U1N ; 1U1O ; 1U1P ; 1U1Q ; 1U1R ; 1UP1 ; 2H4M ; 2LYV ; 2UP1 ; 4YOE ; 5MPG ; 5MPL ; 5ZGD ; 5ZGL ; 6BXX ; 6DCL ; 6J60 ; 7BX7
Function Involved in the packaging of pre-mRNA into hnRNP particles, transport of poly(A) mRNA from the nucleus to the cytoplasm and may modulate splice site selection. May bind to specific miRNA hairpins. Binds to the IRES and thereby inhibits the translation of the apoptosis protease activating factor APAF1.; (Microbial infection) May play a role in HCV RNA replication.; (Microbial infection) Cleavage by Enterovirus 71 protease 3C results in increased translation of apoptosis protease activating factor APAF1, leading to apoptosis.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Organic acids and derivatives
            Arginine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Arginine decrease (48 hours)
                      Induced Change HNRNPA1 protein expression levels: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Colon cancer [ICD-11: 2B90]
                      Details It is reported that arginine decrease causes the decrease of HNRNPA1 protein expression compared with control group.
References
1 Arginine deficiency in preconfluent intestinal Caco-2 cells modulates expression of proteins involved in proliferation, apoptosis, and heat shock response. Proteomics. 2007 Feb;7(4):565-577.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.