Details of Protein
| General Information of Protein (ID: PRT01102) | |||||
|---|---|---|---|---|---|
| Name | Glyceraldehyde-3-phosphate dehydrogenase 1 (GAPDH) | ||||
| Synonyms |
Click to Show/Hide Synonyms of This Protein
GAPDH; Peptidyl-cysteine S-nitrosylase GAPDH; CDABP0047; OK/SW-cl.12; GAPDH; GAPD
|
||||
| Gene Name | GAPDH | Gene ID | |||
| UniProt ID | |||||
| Family | Oxidoreductases (EC 1) | ||||
| EC Number | EC: 1.2.1.12 (Click to Show/Hide the Complete EC Tree) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
| Sequence |
MGKVKVGVNGFGRIGRLVTRAAFNSGKVDIVAINDPFIDLNYMVYMFQYDSTHGKFHGTV
KAENGKLVINGNPITIFQERDPSKIKWGDAGAEYVVESTGVFTTMEKAGAHLQGGAKRVI ISAPSADAPMFVMGVNHEKYDNSLKIISNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHA ITATQKTVDGPSGKLWRDGRGALQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTANV SVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAGAG IALNDHFVKLISWYDNEFGYSNRVVDLMAHMASKE |
||||
| Structure | |||||
| Function | Has both glyceraldehyde-3-phosphate dehydrogenase and nitrosylase activities, thereby playing a role in glycolysis and nuclear functions, respectively. Participates in nuclear events including transcription, RNA transport, DNA replication and apoptosis. Nuclear functions are probably due to the nitrosylase activity that mediates cysteine S-nitrosylation of nuclear target proteins such as SIRT1, HDAC2 and PRKDC. Modulates the organization and assembly of the cytoskeleton. Facilitates the CHP1-dependent microtubule and membrane associations through its ability to stimulate the binding of CHP1 to microtubules. Glyceraldehyde-3-phosphate dehydrogenase is a key enzyme in glycolysis that catalyzes the first step of the pathway by converting D-glyceraldehyde 3-phosphate (G3P) into 3-phospho-D-glyceroyl phosphate. Component of the GAIT (gamma interferon-activated inhibitor of translation) complex which mediates interferon-gamma-induced transcript-selective translation inhibition in inflammation processes. Upon interferon-gamma treatment assembles into the GAIT complex which binds to stem loop-containing GAIT elements in the 3'-UTR of diverse inflammatory mRNAs (such as ceruplasmin) and suppresses their translation. | ||||
| Regulatory Network | |||||
| Full List of Metabolite(s) Regulating This Protein | ||||||
|---|---|---|---|---|---|---|
| Organic acids and derivatives | ||||||
| Glutamine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Glutamine decrease (48 hours) | |||||
| Induced Change | GAPDH protein expression levels: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Hepatocellular carcinoma [ICD-11: 2C12] | |||||
| Details | It is reported that glutamine decrease causes the increase of GAPDH protein expression compared with control group. | |||||
| Oxoglutaric acid | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[2] | ||||
| Introduced Variation | Oxoglutaric acid addition (336 hours) | |||||
| Induced Change | GAPDH protein expression levels: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Parkinsonism [ICD-11: 8A00] | |||||
| Details | It is reported that oxoglutaric acid addition causes the increase of GAPDH protein expression compared with control group. | |||||
| Organic oxygen compounds | ||||||
| Glucose | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Glucose decrease (48 hours) | |||||
| Induced Change | GAPDH protein expression levels: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Hepatocellular carcinoma [ICD-11: 2C12] | |||||
| Details | It is reported that glucose decrease causes the increase of GAPDH protein expression compared with control group. | |||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.

