Details of Protein

General Information of Protein (ID: PRT01102)
Name Glyceraldehyde-3-phosphate dehydrogenase 1 (GAPDH)
Synonyms   Click to Show/Hide Synonyms of This Protein
GAPDH; Peptidyl-cysteine S-nitrosylase GAPDH; CDABP0047; OK/SW-cl.12; GAPDH; GAPD
Gene Name GAPDH Gene ID
2597
UniProt ID
P04406
Family Oxidoreductases (EC 1)
EC Number   EC: 1.2.1.12  (Click to Show/Hide the Complete EC Tree)
Oxidoreductase
Aldehyde/oxo donor oxidoreductase
NAD/NADP acceptor oxidoreductase
EC: 1.2.1.12
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MGKVKVGVNGFGRIGRLVTRAAFNSGKVDIVAINDPFIDLNYMVYMFQYDSTHGKFHGTV
KAENGKLVINGNPITIFQERDPSKIKWGDAGAEYVVESTGVFTTMEKAGAHLQGGAKRVI
ISAPSADAPMFVMGVNHEKYDNSLKIISNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHA
ITATQKTVDGPSGKLWRDGRGALQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTANV
SVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAGAG
IALNDHFVKLISWYDNEFGYSNRVVDLMAHMASKE
Structure
1U8F ; 1ZNQ ; 2FEH ; 3GPD ; 4WNC ; 4WNI ; 6ADE ; 6IQ6 ; 6M61 ; 6YND ; 6YNE ; 6YNF ; 6YNH
Function Has both glyceraldehyde-3-phosphate dehydrogenase and nitrosylase activities, thereby playing a role in glycolysis and nuclear functions, respectively. Participates in nuclear events including transcription, RNA transport, DNA replication and apoptosis. Nuclear functions are probably due to the nitrosylase activity that mediates cysteine S-nitrosylation of nuclear target proteins such as SIRT1, HDAC2 and PRKDC. Modulates the organization and assembly of the cytoskeleton. Facilitates the CHP1-dependent microtubule and membrane associations through its ability to stimulate the binding of CHP1 to microtubules. Glyceraldehyde-3-phosphate dehydrogenase is a key enzyme in glycolysis that catalyzes the first step of the pathway by converting D-glyceraldehyde 3-phosphate (G3P) into 3-phospho-D-glyceroyl phosphate. Component of the GAIT (gamma interferon-activated inhibitor of translation) complex which mediates interferon-gamma-induced transcript-selective translation inhibition in inflammation processes. Upon interferon-gamma treatment assembles into the GAIT complex which binds to stem loop-containing GAIT elements in the 3'-UTR of diverse inflammatory mRNAs (such as ceruplasmin) and suppresses their translation.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Organic acids and derivatives
            Glutamine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Glutamine decrease (48 hours)
                      Induced Change GAPDH protein expression levels: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Hepatocellular carcinoma [ICD-11: 2C12]
                      Details It is reported that glutamine decrease causes the increase of GAPDH protein expression compared with control group.
            Oxoglutaric acid Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [2]
                      Introduced Variation Oxoglutaric acid addition (336 hours)
                      Induced Change GAPDH protein expression levels: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Parkinsonism [ICD-11: 8A00]
                      Details It is reported that oxoglutaric acid addition causes the increase of GAPDH protein expression compared with control group.
      Organic oxygen compounds
            Glucose Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Glucose decrease (48 hours)
                      Induced Change GAPDH protein expression levels: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Hepatocellular carcinoma [ICD-11: 2C12]
                      Details It is reported that glucose decrease causes the increase of GAPDH protein expression compared with control group.
References
1 cMyc-mediated activation of serine biosynthesis pathway is critical for cancer progression under nutrient deprivation conditions. Cell Res. 2015 Apr;25(4):429-44.
2 Dietary keto-acid feed-back on pituitary activity in gilthead sea bream: effects of oral doses of AKG. A proteomic approach. Gen Comp Endocrinol. 2010 Dec 1;169(3):284-92.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.