Details of Protein
| General Information of Protein (ID: PRT01094) | |||||
|---|---|---|---|---|---|
| Name | Eukaryotic translation initiation factor 5A (EIF5A) | ||||
| Synonyms |
Click to Show/Hide Synonyms of This Protein
eIF-5A-1; eIF-5A1; Eukaryotic initiation factor 5A isoform 1; eIF-5A; eIF-4D; Eif5a
|
||||
| Gene Name | Eif5a | Gene ID | |||
| UniProt ID | |||||
| Family | Translation initiation factor (TIF) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
| Sequence |
MADDLDFETGDAGASATFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVG
IDIFTGKKYEDICPSTHNMDVPNIKRNDFQLIGIQDGYLSLLQDSGEVREDLRLPEGDLG KEIEQKYDCGEEILITVLSAMTEEAAVAIKAMAK |
||||
| Function | mRNA-binding protein involved in translation elongation. Has an important function at the level of mRNA turnover, probably acting downstream of decapping. Involved in actin dynamics and cell cycle progression, mRNA decay and probably in a pathway involved in stress response and maintenance of cell wall integrity. With syntenin SDCBP, functions as a regulator of p53/TP53 and p53/TP53-dependent apoptosis. Regulates also TNF-alpha-mediated apoptosis. Mediates effects of polyamines on neuronal process extension and survival. May play an important role in brain development and function, and in skeletal muscle stem cell differentiation. | ||||
| Regulatory Network | |||||
| Full List of Metabolite(s) Regulating This Protein | ||||||
|---|---|---|---|---|---|---|
| Organic acids and derivatives | ||||||
| Methionine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
 click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Methionine decrease (504 hours) | |||||
| Induced Change | EIF5A protein expression levels: decrease (FC = 0.15) | |||||
| Summary | Introduced Variation
Induced Change
|
|||||
| Disease Status | Fatty liver disease [ICD-11: DB92] | |||||
| Details | It is reported that methionine decrease causes the decrease of EIF5A protein expression compared with control group. | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | Proteomic analysis of mice fed methionine and choline deficient diet reveals marker proteins associated with steatohepatitis. PLoS One. 2015 Apr 7;10(4):e0120577. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.