Details of Protein
General Information of Protein (ID: PRT01093) | |||||
---|---|---|---|---|---|
Name | Catechol-O-methyl-transferase (COMT) | ||||
Synonyms |
Click to Show/Hide Synonyms of This Protein
Comt; Comt1
|
||||
Gene Name | Comt | Gene ID | |||
UniProt ID | |||||
Family | Transferases (EC 2) | ||||
EC Number | EC: 2.1.1.6 (Click to Show/Hide the Complete EC Tree) | ||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
Sequence |
MLLAAVSLGLLLLAFLLLLRHLGWGLVAIGWFEFVQQPVHNLLMGGTKEQRILRHVQQHA
KPGDPQSVLEAIDTYCSEKEWAMNVGDAKGQIMDAVIREYRPSLVLELGAYCGYSAVRMA RLLPPGARLLTMEINPDYAAITQQMLDFAGLQDKVSILIGASQDLIPQLKKKYDVDTLDM VFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSY LEYMKVVDGLEKAVYQGPGSSPVKS |
||||
Structure | |||||
Function | Catalyzes the O-methylation, and thereby the inactivation, of catecholamine neurotransmitters and catechol hormones. Also shortens the biological half-lives of certain neuroactive drugs, like L-DOPA, alpha-methyl DOPA and isoproterenol. | ||||
Regulatory Network | |||||
Full List of Metabolite(s) Regulating This Protein | ||||||
---|---|---|---|---|---|---|
Organic acids and derivatives | ||||||
Methionine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
Detailed Information |
Metabo Info
![]() |
|||||
Regulating Pair |
Experim Info
![]() |
[1] | ||||
Introduced Variation | Methionine addition (5 hours) | |||||
Induced Change | COMT protein expression levels: increase | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Hyperhomocysteinaemia [ICD-11: 3B61] | |||||
Details | It is reported that methionine addition causes the increase of COMT protein expression compared with control group. | |||||
References | |||||
---|---|---|---|---|---|
1 | Regulatory cross-talk of mouse liver polyamine and methionine metabolic pathways: a systemic approach to its physiopathological consequences. Amino Acids. 2012 Feb;42(2-3):577-95. |
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.