Details of Protein
| General Information of Protein (ID: PRT01089) | |||||
|---|---|---|---|---|---|
| Name | PMA1 stabilization in the Golgi protein 1 (PSG1) | ||||
| Synonyms |
Click to Show/Hide Synonyms of This Protein
YKL077W; PSG1
|
||||
| Gene Name | PSG1 | Gene ID | |||
| UniProt ID | |||||
| Family | Immunoglobulin (IMG) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
| Sequence |
MRFHDSILIFFSLASLYQHVHGARQVVRPKEKMTTSEEVKPWLRTVYGSQKELVTPTVIA
GVTFSEKPEETPNPLKPWVSLEHDGRPKTIKPEINKGRTKKGRPDYSTYFKTVSSHTYSY EELKAHNMGPNEVFVEEEYIDEDDTYVSLNPIVRCTPNLYFNKGLAKDIRSEPFCTPYEN SRWKVDKTYFVTWYTRFFTDENSGKVADKVRVHLSYVKENPVEKGNYKRDIPATFFSSEW IDNDNGLMPVEVRDEWLQDQFDRRIVVSVQPIYISDEDFDPLQYGILLYITKGSKVFKPT KEQLALDDAGITNDQWYYVALSIPTVVVVFFVFMYFFLYVNGKNRDFTDVTRKALNKKRR VLGKFSEMKKFKNMKNHKYTELPSYKKTSKQN |
||||
| Function | With EXP1, the specific cargo receptor protein for the plasma membrane ATPase PMA1, is involved in the transport and/or maturation of PMA1. EXP1 and PSG1 probably act sequentially to promote PMA1 sorting between the ER and the Golgi, with EXP1 promoting PMA1 export from the ER to the Golgi while PSG1 has a role in PMA1 maturation or quality control in the Golgi. PSG1 might also couple PMA1 sorting and maturation in the early secretory pathway with the glycosylation machinery (Probable).; PSG1 is cleaved by KEX2 in two stable peptides, PSG1-N' and PSG1-C', the former supporting a role in maturation quality control, the latter having a role in modulating vesicular trafficking. | ||||
| Regulatory Network | |||||
| Full List of Metabolite(s) Regulating This Protein | ||||||
|---|---|---|---|---|---|---|
| Homogeneous non-metal compounds | ||||||
| Nitrogen | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Nitrogen limitation (1.50 hours) | |||||
| Induced Change | PSG1 protein expression levels: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Healthy individual | |||||
| Details | It is reported that nitrogen limitation causes the increase of PSG1 protein expression compared with control group. | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | Proteome analysis of yeast response to various nutrient limitations. Mol Syst Biol. 2006;2:2006.0026. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.

