Details of Protein
General Information of Protein (ID: PRT01076) | |||||
---|---|---|---|---|---|
Name | Phosphoglycerate mutase 1 (PGAM1) | ||||
Synonyms |
Click to Show/Hide Synonyms of This Protein
PGAM 1; BPG-dependent PGAM 1; MPGM 1; Phosphoglyceromutase 1; YKL152C; YKL607; GPM1; GPM
|
||||
Gene Name | GPM1 | Gene ID | |||
UniProt ID | |||||
Family | Isomerases (EC 5) | ||||
EC Number | EC: 5.4.2.11 (Click to Show/Hide the Complete EC Tree) | ||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
Sequence |
MPKLVLVRHGQSEWNEKNLFTGWVDVKLSAKGQQEAARAGELLKEKKVYPDVLYTSKLSR
AIQTANIALEKADRLWIPVNRSWRLNERHYGDLQGKDKAETLKKFGEEKFNTYRRSFDVP PPPIDASSPFSQKGDERYKYVDPNVLPETESLALVIDRLLPYWQDVIAKDLLSGKTVMIA AHGNSLRGLVKHLEGISDADIAKLNIPTGIPLVFELDENLKPSKPSYYLDPEAAAAGAAA VANQGKK |
||||
Structure | |||||
Function | Interconversion of 3- and 2-phosphoglycerate with 2,3-bisphosphoglycerate as the primer of the reaction. Can also Catalyzes the reaction of EC 5.4.2.4 (synthase), but with a reduced activity. | ||||
Regulatory Network | |||||
Full List of Metabolite(s) Regulating This Protein | ||||||
---|---|---|---|---|---|---|
Homogeneous non-metal compounds | ||||||
Nitrogen | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
Detailed Information |
Metabo Info
![]() |
|||||
Regulating Pair |
Experim Info
![]() |
[1] | ||||
Introduced Variation | Nitrogen limitation (1.50 hours) | |||||
Induced Change | GPM1 protein expression levels: increase | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Healthy individual | |||||
Details | It is reported that nitrogen limitation causes the increase of GPM1 protein expression compared with control group. | |||||
References | |||||
---|---|---|---|---|---|
1 | Proteome analysis of yeast response to various nutrient limitations. Mol Syst Biol. 2006;2:2006.0026. |
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.