Details of Protein

General Information of Protein (ID: PRT01065)
Name Tyrosine kinase activator protein 1 (TKA-1)
Synonyms   Click to Show/Hide Synonyms of This Protein
NHERF-2; NHE3 kinase A regulatory protein E3KARP; SRY-interacting protein 1; SIP-1; Sodium-hydrogen exchanger regulatory factor 2; Solute carrier family 9 isoform A3 regulatory factor 2; Tyrosine kinase activator protein 1; TKA-1; SLC9A3R2; NHERF2
Gene Name SLC9A3R2 Gene ID
9351
UniProt ID
Q15599
Family Ezrin-radixin-moesin (ERM)
TC Number   TC: 8.A.24.1.2  (Click to Show/Hide the Complete TC Tree)
The Ezrin/Radixin/Moesin-binding Phosphoprotein 50 (EBP50) Family
.
TC: 8.A.24.1.2
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MAAPEPLRPRLCRLVRGEQGYGFHLHGEKGRRGQFIRRVEPGSPAEAAALRAGDRLVEVN
GVNVEGETHHQVVQRIKAVEGQTRLLVVDQETDEELRRRQLTCTEEMAQRGLPPAHDPWE
PKPDWAHTGSHSSEAGKKDVSGPLRELRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVD
PGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVDPETDEHFKRLR
VTPTEEHVEGPLPSPVTNGTSPAQLNGGSACSSRSDLPGSDKDTEDGSAWKQDPFQESGL
HLSPTAAEAKEKARAMRVNKRAPQMDWNRKREIFSNF
Structure
2D11 ; 2HE4 ; 2OCS ; 4P0C
Function Scaffold protein that connects plasma membrane proteins with members of the ezrin/moesin/radixin family and thereby helps to link them to the actin cytoskeleton and to regulate their surface expression. Necessary for cAMP-mediated phosphorylation and inhibition of SLC9A3. May also act as scaffold protein in the nucleus.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Organic acids and derivatives
            Glutamine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Glutamine absence (16 hours)
                      Induced Change SLC9A3R2 protein abundance levels: increase (FC = 1.32)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Hepatocellular carcinoma [ICD-11: 2C12]
                      Details It is reported that glutamine absence causes the increase of SLC9A3R2 protein abundance compared with control group.
References
1 Quantitative proteomics analysis reveals glutamine deprivation activates fatty acid -oxidation pathway in HepG2 cells. Amino Acids. 2016 May;48(5):1297-307.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.