Details of Protein
General Information of Protein (ID: PRT01064) | |||||
---|---|---|---|---|---|
Name | Dehydropeptidase I (DPEP1) | ||||
Synonyms |
Click to Show/Hide Synonyms of This Protein
Beta-lactamase; Dehydropeptidase-I; Microsomal dipeptidase; Renal dipeptidase; hRDP; DPEP1; MDP; RDP
|
||||
Gene Name | DPEP1 | Gene ID | |||
UniProt ID | |||||
Family | Hydrolases (EC 3) | ||||
EC Number | EC: 3.4.13.19 (Click to Show/Hide the Complete EC Tree) | ||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
Sequence |
MWSGWWLWPLVAVCTADFFRDEAERIMRDSPVIDGHNDLPWQLLDMFNNRLQDERANLTT
LAGTHTNIPKLRAGFVGGQFWSVYTPCDTQNKDAVRRTLEQMDVVHRMCRMYPETFLYVT SSAGIRQAFREGKVASLIGVEGGHSIDSSLGVLRALYQLGMRYLTLTHSCNTPWADNWLV DTGDSEPQSQGLSPFGQRVVKELNRLGVLIDLAHVSVATMKATLQLSRAPVIFSHSSAYS VCASRRNVPDDVLRLVKQTDSLVMVNFYNNYISCTNKANLSQVADHLDHIKEVAGARAVG FGGDFDGVPRVPEGLEDVSKYPDLIAELLRRNWTEAEVKGALADNLLRVFEAVEQASNLT QAPEEEPIPLDQLGGSCRTHYGYSSGASSLHRHWGLLLASLAPLVLCLSLL |
||||
Structure | |||||
Function | Hydrolyzes a wide range of dipeptides including the conversion of leukotriene D4 to leukotriene E4. Hydrolyzes cystinyl-bis-glycine (cys-bis-gly) formed during glutathione degradation. Possesses also beta lactamase activity and hydrolytically inactivates beta-lactam antibiotics.; Independently of its dipeptidase activity acts as an adhesion receptor for neutrophils recruitement from bloodstream into inflammed lungs and liver. | ||||
Regulatory Network | |||||
Full List of Metabolite(s) Regulating This Protein | ||||||
---|---|---|---|---|---|---|
Organic acids and derivatives | ||||||
Glutamine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
Detailed Information |
Metabo Info
![]() |
|||||
Regulating Pair |
Experim Info
![]() |
[1] | ||||
Introduced Variation | Glutamine addition (12 hours) | |||||
Induced Change | DPEP1 protein expression levels: decrease | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Inflammatory bowel disease [ICD-11: DD72] | |||||
Details | It is reported that glutamine addition causes the decrease of DPEP1 protein expression compared with control group. | |||||
References | |||||
---|---|---|---|---|---|
1 | Proteomic analysis of glutamine-treated human intestinal epithelial HCT-8 cells under basal and inflammatory conditions. Proteomics. 2006 Jul;6(13):3926-37. |
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.