Details of Protein
| General Information of Protein (ID: PRT01057) | |||||
|---|---|---|---|---|---|
| Name | Cytochrome P450 7A1 (CYP7A1) | ||||
| Synonyms |
Click to Show/Hide Synonyms of This Protein
24-hydroxycholesterol 7-alpha-hydroxylase; CYPVII; Cholesterol 7-alpha-hydroxylase; Cholesterol 7-alpha-monooxygenase; CYP7A1; CYP7
|
||||
| Gene Name | CYP7A1 | Gene ID | |||
| UniProt ID | |||||
| Family | Oxidoreductases (EC 1) | ||||
| EC Number | EC: 1.14.14.26 (Click to Show/Hide the Complete EC Tree) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
| Sequence |
MMTTSLIWGIAIAACCCLWLILGIRRRQTGEPPLENGLIPYLGCALQFGANPLEFLRANQ
RKHGHVFTCKLMGKYVHFITNPLSYHKVLCHGKYFDWKKFHFATSAKAFGHRSIDPMDGN TTENINDTFIKTLQGHALNSLTESMMENLQRIMRPPVSSNSKTAAWVTEGMYSFCYRVMF EAGYLTIFGRDLTRRDTQKAHILNNLDNFKQFDKVFPALVAGLPIHMFRTAHNAREKLAE SLRHENLQKRESISELISLRMFLNDTLSTFDDLEKAKTHLVVLWASQANTIPATFWSLFQ MIRNPEAMKAATEEVKRTLENAGQKVSLEGNPICLSQAELNDLPVLDSIIKESLRLSSAS LNIRTAKEDFTLHLEDGSYNIRKDDIIALYPQLMHLDPEIYPDPLTFKYDRYLDENGKTK TTFYCNGLKLKYYYMPFGSGATICPGRLFAIHEIKQFLILMLSYFELELIEGQAKCPPLD QSRAGLGILPPLNDIEFKYKFKHL |
||||
| Structure | |||||
| Function | A cytochrome P450 monooxygenase involved in the metabolism of endogenous cholesterol and its oxygenated derivatives (oxysterols). Mechanistically, uses molecular oxygen inserting one oxygen atom into a substrate, and reducing the second into a water molecule, with two electrons provided by NADPH via cytochrome P450 reductase (CPR; NADPH-ferrihemoprotein reductase). Functions as a critical regulatory enzyme of bile acid biosynthesis and cholesterol homeostasis. Catalyzes the hydroxylation of carbon hydrogen bond at 7-alpha position of cholesterol, a rate-limiting step in cholesterol catabolism and bile acid biosynthesis. 7-alpha hydroxylates several oxysterols, including 4beta-hydroxycholesterol and 24-hydroxycholesterol. Catalyzes the oxidation of the 7,8 double bond of 7-dehydrocholesterol and lathosterol with direct and predominant formation of the 7-keto derivatives. | ||||
| Regulatory Network | |||||
| Full List of Metabolite(s) Regulating This Protein | ||||||
|---|---|---|---|---|---|---|
| Lipids and lipid-like molecules | ||||||
| Bile acid | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
 click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Bile acid addition (36 hours) | |||||
| Induced Change | CYP7A1 protein abundance levels: decrease | |||||
| Summary | Introduced Variation
Induced Change
|
|||||
| Disease Status | Hepatocellular carcinoma [ICD-11: 2C12] | |||||
| Details | It is reported that bile acid addition causes the decrease of CYP7A1 protein abundance compared with control group. | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | Identification of a nuclear receptor for bile acids. Science. 1999 May 21;284(5418):1362-5. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.