Details of Protein

General Information of Protein (ID: PRT01029)
Name Claudin-1 (CLDN1)
Synonyms   Click to Show/Hide Synonyms of This Protein
Senescence-associated epithelial membrane protein; UNQ481/PRO944; CLDN1; CLD1; SEMP1
Gene Name CLDN1 Gene ID
9076
UniProt ID
O95832
Family Claudin tight junction (Clau)
TC Number   TC: 1.H.1.1.14  (Click to Show/Hide the Complete TC Tree)
The Claudin Tight Junction (Claudin1) Family
.
TC: 1.H.1.1.14
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MANAGLQLLGFILAFLGWIGAIVSTALPQWRIYSYAGDNIVTAQAMYEGLWMSCVSQSTG
QIQCKVFDSLLNLSSTLQATRALMVVGILLGVIAIFVATVGMKCMKCLEDDEVQKMRMAV
IGGAIFLLAGLAILVATAWYGNRIVQEFYDPMTPVNARYEFGQALFTGWAAASLCLLGGA
LLCCSCPRKTTSYPTPRPYPKPAPSSGKDYV
Function Claudins function as major constituents of the tight junction complexes that regulate the permeability of epithelia. While some claudin family members play essential roles in the formation of impermeable barriers, others mediate the permeability to ions and small molecules. Often, several claudin family members are coexpressed and interact with each other, and this determines the overall permeability. CLDN1 is required to prevent the paracellular diffusion of small molecules through tight junctions in the epidermis and is required for the normal barrier function of the skin. Required for normal water homeostasis and to prevent excessive water loss through the skin, probably via an indirect effect on the expression levels of other proteins, since CLDN1 itself seems to be dispensable for water barrier formation in keratinocyte tight junctions.; (Microbial infection) Acts as a co-receptor for hepatitis C virus (HCV) in hepatocytes. Associates with CD81 and the CLDN1-CD81 receptor complex is essential for HCV entry into host cell. Acts as a receptor for dengue virus.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Organic acids and derivatives
            Glutamine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Glutamine decrease (504 hours)
                      Induced Change CLDN1 protein expression levels: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Colon cancer [ICD-11: 2B90]
                      Details It is reported that glutamine decrease causes the decrease of CLDN1 protein expression compared with control group.
References
1 Glutamine regulates Caco-2 cell tight junction proteins. Am J Physiol Gastrointest Liver Physiol. 2004 Sep;287(3):G726-33.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.