Details of Protein
General Information of Protein (ID: PRT01012) | |||||
---|---|---|---|---|---|
Name | Beta centractin (ACTR1B) | ||||
Synonyms |
Click to Show/Hide Synonyms of This Protein
Actin-related protein 1B; ARP1B; ACTR1B; CTRN2
|
||||
Gene Name | ACTR1B | Gene ID | |||
UniProt ID | |||||
Family | Actin (ACT) | ||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
Sequence |
MESYDIIANQPVVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHMRVMAGALEGDLFIGP
KAEEHRGLLTIRYPMEHGVVRDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPSKN REKAAEVFFETFNVPALFISMQAVLSLYATGRTTGVVLDSGDGVTHAVPIYEGFAMPHSI MRVDIAGRDVSRYLRLLLRKEGVDFHTSAEFEVVRTIKERACYLSINPQKDEALETEKVQ YTLPDGSTLDVGPARFRAPELLFQPDLVGDESEGLHEVVAFAIHKSDMDLRRTLFANIVL SGGSTLFKGFGDRLLSEVKKLAPKDIKIKISAPQERLYSTWIGGSILASLDTFKKMWVSK KEYEEDGSRAIHRKTF |
||||
Function | Component of a multi-subunit complex involved in microtubule based vesicle motility. It is associated with the centrosome. | ||||
Regulatory Network | |||||
Full List of Metabolite(s) Regulating This Protein | ||||||
---|---|---|---|---|---|---|
Organic oxygen compounds | ||||||
Glucose | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
Detailed Information |
Metabo Info
![]() |
|||||
Regulating Pair |
Experim Info
![]() |
[1] | ||||
Introduced Variation | Glucose addition (16 hours) | |||||
Induced Change | ACTR1B protein expression levels: increase (FC = 4) | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Hyperglycemic hyperosmolar syndrome [ICD-11: 5A20] | |||||
Details | It is reported that glucose addition causes the increase of ACTR1B protein expression compared with control group. | |||||
References | |||||
---|---|---|---|---|---|
1 | High-glucose-induced changes in macrophage secretome: regulation of immune response. Mol Cell Biochem. 2019 Feb;452(1-2):51-62. |
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.