Details of Protein

General Information of Protein (ID: PRT01006)
Name Dyads accumulation 2 (ADY2)
Synonyms   Click to Show/Hide Synonyms of This Protein
Ammonia transport outward protein 1; YCR010C; YCR10C; ADY2; ATO1
Gene Name ADY2 Gene ID
850368
UniProt ID
P25613
Family Acetate uptake transporter (AceTr)
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MSDKEQTSGNTDLENAPAGYYSSHDNDVNGVAEDERPSHDSLGKIYTGGDNNEYIYIGRQ
KFLKSDLYQAFGGTLNPGLAPAPVHKFANPAPLGLSAFALTTFVLSMFNARAQGITVPNV
VVGCAMFYGGLVQLIAGIWEIALENTFGGTALCSYGGFWLSFAAIYIPWFGILEAYEDNE
SDLNNALGFYLLGWAIFTFGLTVCTMKSTVMFFLLFFLLALTFLLLSIGHFANRLGVTRA
GGVLGVVVAFIAWYNAYAGVATKQNSYVLARPFPLPSTERVIF
Function Transporter protein required for ammonia export and acetate uptake and resistance. Necessary for up-regulation and down-regulation of meiotic plaque (MP) component levels in a dependency on external acetate. Has a role in ascus formation.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Organic oxygen compounds
            Glucose Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Glucose addition (1.50 hours)
                      Induced Change ADY2 protein expression levels: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that glucose addition causes the increase of ADY2 protein expression compared with control group.
References
1 Proteome analysis of yeast response to various nutrient limitations. Mol Syst Biol. 2006;2:2006.0026.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.