Details of Protein
General Information of Protein (ID: PRT01000) | |||||
---|---|---|---|---|---|
Name | Fructose-bisphosphate aldolase B (ALDOB) | ||||
Synonyms |
Click to Show/Hide Synonyms of This Protein
Liver-type aldolase; ALDOB; ALDB
|
||||
Gene Name | ALDOB | Gene ID | |||
UniProt ID | |||||
Family | Lyases (EC 4) | ||||
EC Number | EC: 4.1.2.13 (Click to Show/Hide the Complete EC Tree) | ||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
Sequence |
MAHRFPALTQEQKKELSEIAQSIVANGKGILAADESVGTMGNRLQRIKVENTEENRRQFR
EILFSVDSSINQSIGGVILFHETLYQKDSQGKLFRNILKEKGIVVGIKLDQGGAPLAGTN KETTIQGLDGLSERCAQYKKDGVDFGKWRAVLRIADQCPSSLAIQENANALARYASICQQ NGLVPIVEPEVIPDGDHDLEHCQYVTEKVLAAVYKALNDHHVYLEGTLLKPNMVTAGHAC TKKYTPEQVAMATVTALHRTVPAAVPGICFLSGGMSEEDATLNLNAINLCPLPKPWKLSF SYGRALQASALAAWGGKAANKEATQEAFMKRAMANCQAAKGQYVHTGSSGAASTQSLFTA CYTY |
||||
Structure | |||||
Regulatory Network | |||||
Full List of Metabolite(s) Regulating This Protein | ||||||
---|---|---|---|---|---|---|
Organic acids and derivatives | ||||||
Glutamine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
Detailed Information |
Metabo Info
![]() |
|||||
Regulating Pair |
Experim Info
![]() |
[1] | ||||
Introduced Variation | Glutamine absence (16 hours) | |||||
Induced Change | ALDOB protein abundance levels: increase (FC = 2.83) | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Hepatocellular carcinoma [ICD-11: 2C12] | |||||
Details | It is reported that glutamine absence causes the increase of ALDOB protein abundance compared with control group. | |||||
Organic oxygen compounds | ||||||
Glucose | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
Detailed Information |
Metabo Info
![]() |
|||||
Regulating Pair |
Experim Info
![]() |
[2] | ||||
Introduced Variation | Glucose decrease (48 hours) | |||||
Induced Change | ALDOB protein expression levels: increase | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Hepatocellular carcinoma [ICD-11: 2C12] | |||||
Details | It is reported that glucose decrease causes the increase of ALDOB protein expression compared with control group. | |||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.