Details of Protein

General Information of Protein (ID: PRT00989)
Name Hypoxia-inducible gene 1 protein (HIG1)
Synonyms   Click to Show/Hide Synonyms of This Protein
Hypoxia-inducible gene 1 protein; HIG1 domain family member 1A, mitochondrial; HIGD1A; Higd1a; Hig1
Gene Name Higd1a Gene ID
56295
UniProt ID
Q9JLR9
Family Transmembrane protein (TMEM)
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MSTNTDLSLSSYDEGQGSKFIRKAKETPFVPIGMAGFAAIVAYGLYKLKSRGNTKMSIHL
IHMRVAAQGFVVGAMTLGMGYSMYQEFWANPKPKP
Function Proposed subunit of cytochrome c oxidase (COX, complex IV), which is the terminal component of the mitochondrial respiratory chain that catalyzes the reduction of oxygen to water. May play a role in the assembly of respiratory supercomplexes.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Organic oxygen compounds
            Glucose Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Glucose (low concentration) addition (17.50 hours)
                      Induced Change HIGD1A protein abundance levels: increase (FC = 2.03)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Cerebral stroke [ICD-11: 8B11]
                      Details It is reported that low glucose addition causes the increase of HIGD1A protein abundance compared with control group.
References
1 Quantitative Proteomics Reveals the Beneficial Effects of Low Glucose on Neuronal Cell Survival in an in vitro Ischemic Penumbral Model. Front Cell Neurosci. 2020 Sep 1;14:272.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.