Details of Protein
| General Information of Protein (ID: PRT00967) | |||||
|---|---|---|---|---|---|
| Name | SRP-independent targeting protein 3 (PHO88) | ||||
| Synonyms |
Click to Show/Hide Synonyms of This Protein
Inorganic phosphate transport protein PHO88; Phosphate metabolism protein PHO88; YBR106W; YBR0835; PHO88; SND3
|
||||
| Gene Name | PHO88 | Gene ID | |||
| UniProt ID | |||||
| Family | SRP-independent targeting (SND) | ||||
| TC Number | TC: 9.A.64.1.1 (Click to Show/Hide the Complete TC Tree) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
| Sequence |
MNPQVSNIIIMLVMMQLSRRIDMEDPTIIMYIRILYCSSIGISWIIYQMARKRIVAKNDM
TTMKYVEPGNAMSGEGEKLQVTTVRDYDLKEIDSAIKSIYTGMAMMGFMHLYLKYTNPLF MQSISPVKSALEHNEVKIHLFGKPATGDLKRPFKAPSLFGGMGQTGPKTDKKSIEEAERA GNAGVKAE |
||||
| Function | Functions in the SND pathway, a SRP (signal recognition particle) and GET (guided entry of tail-anchored proteins) independent pathway for targeting a broad range of substrate proteins to the endoplasmic reticulum. SND functions in parallel to GET in targeting proteins with downstream hydrophobic motifs. Involved in inorganic phosphate uptake. Also involved in telomere length regulation and maintenance. | ||||
| Regulatory Network | |||||
| Full List of Metabolite(s) Regulating This Protein | ||||||
|---|---|---|---|---|---|---|
| Homogeneous non-metal compounds | ||||||
| Nitrogen | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
 click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Nitrogen limitation (24 hours) | |||||
| Induced Change | PHO88 protein expression levels: increase | |||||
| Summary | Introduced Variation
Induced Change
|
|||||
| Disease Status | Healthy individual | |||||
| Details | It is reported that nitrogen limitation causes the increase of PHO88 protein expression compared with control group. | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | Proteome analysis of yeast response to various nutrient limitations. Mol Syst Biol. 2006;2:2006.0026. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.