Details of Protein
| General Information of Protein (ID: PRT00949) | |||||
|---|---|---|---|---|---|
| Name | NADH dehydrogenase [ubiquinone] 1 C2 (NDUFC2) | ||||
| Synonyms |
Click to Show/Hide Synonyms of This Protein
Complex I-B14.5b; CI-B14.5b; NADH-ubiquinone oxidoreductase subunit B14.5b; Ndufc2
|
||||
| Gene Name | Ndufc2 | Gene ID | |||
| UniProt ID | |||||
| Family | Ubiquitin/ubiquinone (UbiQ) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
| Sequence |
MMNGRPGHEPLKFLPDEARSLPPPKLNDPRLVYMGLLGYCTGLMDNMLRMRPVMRAGLHR
QLLFVTSFVFAGYFYLKRQNYLYAVKDHDMFGYIKLHPEDFPEKEKKTYAEILEPFHPVR |
||||
| Structure | |||||
| Function | Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. | ||||
| Regulatory Network | |||||
| Full List of Metabolite(s) Regulating This Protein | ||||||
|---|---|---|---|---|---|---|
| Organic oxygen compounds | ||||||
| Glucose | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
 click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Glucose (low concentration) addition (17.50 hours) | |||||
| Induced Change | NDUFC2 protein abundance levels: increase (FC = 1.62) | |||||
| Summary | Introduced Variation
Induced Change
|
|||||
| Disease Status | Cerebral stroke [ICD-11: 8B11] | |||||
| Details | It is reported that low glucose addition causes the increase of NDUFC2 protein abundance compared with control group. | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | Quantitative Proteomics Reveals the Beneficial Effects of Low Glucose on Neuronal Cell Survival in an in vitro Ischemic Penumbral Model. Front Cell Neurosci. 2020 Sep 1;14:272. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.