Details of Protein
General Information of Protein (ID: PRT00922) | |||||
---|---|---|---|---|---|
Name | Adaptin ear-binding protein 1 (NECAP1) | ||||
Synonyms |
Click to Show/Hide Synonyms of This Protein
NECAP endocytosis-associated protein 1; NECAP-1; NECAP1
|
||||
Gene Name | NECAP1 | Gene ID | |||
UniProt ID | |||||
Family | Endocytosis protein (Endo) | ||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
Sequence |
MATELEYESVLCVKPDVSVYRIPPRASNRGYRASDWKLDQPDWTGRLRITSKGKTAYIKL
EDKVSGELFAQAPVEQYPGIAVETVTDSSRYFVIRIQDGTGRSAFIGIGFTDRGDAFDFN VSLQDHFKWVKQESEISKESQEMDARPKLDLGFKEGQTIKLCIGNITNKKGGASKPRTAR GGGLSLLPPPPGGKVTIPPPSSSVAISNHVTPPPIPKSNHGGSDADILLDLDSPAPVTTP APTPVSVSNDLWGDFSTASSSVPNQAPQPSNWVQF |
||||
Structure | |||||
Function | Involved in endocytosis. | ||||
Regulatory Network | |||||
Full List of Metabolite(s) Regulating This Protein | ||||||
---|---|---|---|---|---|---|
Organic acids and derivatives | ||||||
Glutamine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
Detailed Information |
Metabo Info
![]() |
|||||
Regulating Pair |
Experim Info
![]() |
[1] | ||||
Introduced Variation | Glutamine absence (16 hours) | |||||
Induced Change | NECAP1 protein abundance levels: increase (FC = 1.49) | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Hepatocellular carcinoma [ICD-11: 2C12] | |||||
Details | It is reported that glutamine absence causes the increase of NECAP1 protein abundance compared with control group. | |||||
References | |||||
---|---|---|---|---|---|
1 | Quantitative proteomics analysis reveals glutamine deprivation activates fatty acid -oxidation pathway in HepG2 cells. Amino Acids. 2016 May;48(5):1297-307. |
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.