Details of Protein

General Information of Protein (ID: PRT00914)
Name Apoptosis mediating surface antigen FAS (CD95)
Synonyms   Click to Show/Hide Synonyms of This Protein
Apo-1 antigen; Apoptosis-mediating surface antigen FAS; FASLG receptor; CD antigen CD95; Fas; Apt1; Tnfrsf6
Gene Name Fas Gene ID
14102
UniProt ID
P25446
Family Cytokine receptor (CytR)
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MLWIWAVLPLVLAGSQLRVHTQGTNSISESLKLRRRVRETDKNCSEGLYQGGPFCCQPCQ
PGKKKVEDCKMNGGTPTCAPCTEGKEYMDKNHYADKCRRCTLCDEEHGLEVETNCTLTQN
TKCKCKPDFYCDSPGCEHCVRCASCEHGTLEPCTATSNTNCRKQSPRNRLWLLTILVLLI
PLVFIYRKYRKRKCWKRRQDDPESRTSSRETIPMNASNLSLSKYIPRIAEDMTIQEAKKF
ARENNIKEGKIDEIMHDSIQDTAEQKVQLLLCWYQSHGKSDAYQDLIKGLKKAECRRTLD
KFQDMVQKDLGKSTPDTGNENEGQCLE
Structure
2NA6 ; 3OQ9
Function Receptor for TNFSF6/FASLG. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. FAS-mediated apoptosis may have a role in the induction of peripheral tolerance, in the antigen-stimulated suicide of mature T-cells, or both.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Nucleosides, nucleotides, and analogues
            AICAR Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation AICAR addition (24 hours)
                      Induced Change FAS mRNA levels: increase (FC = 0.62)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Obesity [ICD-11: 5B81]
                      Details It is reported that AICAR addition causes the increase of FAS mRNA levels compared with control group.
References
1 Identification and characterization of a small molecule AMPK activator that treats key components of type 2 diabetes and the metabolic syndrome. Cell Metab. 2006 Jun;3(6):403-16.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.