Details of Protein

General Information of Protein (ID: PRT00899)
Name Matrix metalloproteinase-13 (MMP-13)
Synonyms   Click to Show/Hide Synonyms of This Protein
Matrix metalloproteinase-13; MMP-13; MMP13
Gene Name MMP13 Gene ID
4322
UniProt ID
P45452
Family Hydrolases (EC 3)
EC Number   EC: 3.4.24.-  (Click to Show/Hide the Complete EC Tree)
Hydrolases
Peptidase
Metallopeptidase
EC: 3.4.24.-
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MHPGVLAAFLFLSWTHCRALPLPSGGDEDDLSEEDLQFAERYLRSYYHPTNLAGILKENA
ASSMTERLREMQSFFGLEVTGKLDDNTLDVMKKPRCGVPDVGEYNVFPRTLKWSKMNLTY
RIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFTRLHDGIADIMISFGIKEHGDFYPFDG
PSGLLAHAFPPGPNYGGDAHFDDDETWTSSSKGYNLFLVAAHEFGHSLGLDHSKDPGALM
FPIYTYTGKSHFMLPDDDVQGIQSLYGPGDEDPNPKHPKTPDKCDPSLSLDAITSLRGET
MIFKDRFFWRLHPQQVDAELFLTKSFWPELPNRIDAAYEHPSHDLIFIFRGRKFWALNGY
DILEGYPKKISELGLPKEVKKISAAVHFEDTGKTLLFSGNQVWRYDDTNHIMDKDYPRLI
EEDFPGIGDKVDAVYEKNGYIYFFNGPIQFEYSIWSNRIVRVMPANSILWC
Structure
1EUB ; 1FLS ; 1FM1 ; 1PEX ; 1UC1 ; 1XUC ; 1XUD ; 1XUR ; 1YOU ; 1ZTQ ; 2D1N ; 2E2D ; 2OW9 ; 2OZR ; 2PJT ; 2YIG ; 3ELM ; 3I7G ; 3I7I ; 3KEC ; 3KEJ ; 3KEK ; 3KRY ; 3LJZ ; 3O2X ; 3TVC ; 3WV1 ; 3WV2 ; 3WV3 ; 3ZXH ; 456C ; 4A7B ; 4FU4 ; 4FVL ; 4G0D ; 4JP4 ; 4JPA ; 4L19 ; 5B5O ; 5B5P ; 5BOT ; 5BOY ; 5BPA ; 5UWK ; 5UWL ; 5UWM ; 5UWN ; 830C
Function Plays a role in the degradation of extracellular matrix proteins including fibrillar collagen, fibronectin, TNC and ACAN. Cleaves triple helical collagens, including type I, type II and type III collagen, but has the highest activity with soluble type II collagen. Can also degrade collagen type IV, type XIV and type X. May also function by activating or degrading key regulatory proteins, such as TGFB1 and CCN2. Plays a role in wound healing, tissue remodeling, cartilage degradation, bone development, bone mineralization and ossification. Required for normal embryonic bone development and ossification. Plays a role in the healing of bone fractures via endochondral ossification. Plays a role in wound healing, probably by a mechanism that involves proteolytic activation of TGFB1 and degradation of CCN2. Plays a role in keratinocyte migration during wound healing. May play a role in cell migration and in tumor cell invasion.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Organic acids and derivatives
            Glutamine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Glutamine addition (12 hours)
                      Induced Change MMP13 protein expression levels: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Inflammatory bowel disease [ICD-11: DD72]
                      Details It is reported that glutamine addition causes the increase of MMP13 protein expression compared with control group.
References
1 Proteomic analysis of glutamine-treated human intestinal epithelial HCT-8 cells under basal and inflammatory conditions. Proteomics. 2006 Jul;6(13):3926-37.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.