Details of Protein

General Information of Protein (ID: PRT00893)
Name Protein transport protein SSS1 (SSS1)
Synonyms   Click to Show/Hide Synonyms of This Protein
Sec61 complex subunit SSS1; Sec61 complex subunit gamma; Ssh1 complex subunit SSS1; Ssh1 complex subunit gamma; YDR086C; D4475; SSS1
Gene Name SSS1 Gene ID
851659
UniProt ID
P35179
Family General secretory pathway (SEC)
TC Number   TC: 3.A.5.8.1  (Click to Show/Hide the Complete TC Tree)
The General Secretory Pathway (Sec) Family
.
TC: 3.A.5.8.1
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MARASEKGEEKKQSNNQVEKLVEAPVEFVREGTQFLAKCKKPDLKEYTKIVKAVGIGFIA
VGIIGYAIKLIHIPIRYVIV
Structure
2WW9 ; 2WWA ; 6N3Q ; 6ND1 ; 7AFT ; 7KAI ; 7KAJ ; 7KAP ; 7KAQ ; 7KAR ; 7KAS ; 7KAT ; 7KAU ; 7KB5
Function Part of the Sec61 complex, which is the major component of channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER). The functional states of the translocon complex include co- and post-translational ER import, cotranslational membrane protein integration and retrograde transport of misfolded proteins out of the ER. In the cotranslational pathway, ribosomes synthesizing presecretory proteins are targeted to the translocon by the cytosolic signal recognition particle (SRP) and its ER-localized receptor. The association of the Sec61 complex with the ribosome is mediated by the 28S rRNA of the large ribosomal subunit. SRP-independent post-translational translocation requires the association of additional factors, such as the Sec62/63 complex and KAR2. Also part of the Ssh1 complex, which probably is the major component of a channel-forming translocon complex that may function exclusively in the cotranslational pathway of protein ER import.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Homogeneous non-metal compounds
            Nitrogen Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Nitrogen limitation (1.50 hours)
                      Induced Change SSS1 protein expression levels: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that nitrogen limitation causes the increase of SSS1 protein expression compared with control group.
References
1 Proteome analysis of yeast response to various nutrient limitations. Mol Syst Biol. 2006;2:2006.0026.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.