Details of Protein

General Information of Protein (ID: PRT00885)
Name Phosphatidylinositol glycan anchor biosynthesis F (PIGF)
Synonyms   Click to Show/Hide Synonyms of This Protein
Phosphatidylinositol-glycan biosynthesis class F protein; PIG-F; GPI11 homolog; PIGF
Gene Name PIGF Gene ID
5281
UniProt ID
Q07326
Family Growth factor (GF)
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MKDNDIKRLLYTHLLCIFSIILSVFIPSLFLENFSILETHLTWLCICSGFVTAVNLVLYL
VVKPNTSSKRSSLSHKVTGFLKCCIYFLMSCFSFHVIFVLYGAPLIELALETFLFAVILS
TFTTVPCLCLLGPNLKAWLRVFSRNGVTSIWENSLQITTISSFVGAWLGALPIPLDWERP
WQVWPISCTLGATFGYVAGLVISPLWIYWNRKQLTYKNN
Function Involved in GPI-anchor biosynthesis through the transfer of ethanolamine phosphate to the third mannose of GPI.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Organic oxygen compounds
            Glucose Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Glucose decrease (36 hours)
                      Induced Change PIGF protein expression levels: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that glucose decrease causes the decrease of PIGF protein expression compared with control group.
References
1 Glucose withdrawal induces Endothelin 1 release with significant angiogenic effect from first trimester (FTM), but not term human umbilical cord perivascular cells (HUCPVC). Angiogenesis. 2020 May;23(2):131-144.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.