Details of Protein
| General Information of Protein (ID: PRT00885) | |||||
|---|---|---|---|---|---|
| Name | Phosphatidylinositol glycan anchor biosynthesis F (PIGF) | ||||
| Synonyms |
Click to Show/Hide Synonyms of This Protein
Phosphatidylinositol-glycan biosynthesis class F protein; PIG-F; GPI11 homolog; PIGF
|
||||
| Gene Name | PIGF | Gene ID | |||
| UniProt ID | |||||
| Family | Growth factor (GF) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
| Sequence |
MKDNDIKRLLYTHLLCIFSIILSVFIPSLFLENFSILETHLTWLCICSGFVTAVNLVLYL
VVKPNTSSKRSSLSHKVTGFLKCCIYFLMSCFSFHVIFVLYGAPLIELALETFLFAVILS TFTTVPCLCLLGPNLKAWLRVFSRNGVTSIWENSLQITTISSFVGAWLGALPIPLDWERP WQVWPISCTLGATFGYVAGLVISPLWIYWNRKQLTYKNN |
||||
| Function | Involved in GPI-anchor biosynthesis through the transfer of ethanolamine phosphate to the third mannose of GPI. | ||||
| Regulatory Network | |||||
| Full List of Metabolite(s) Regulating This Protein | ||||||
|---|---|---|---|---|---|---|
| Organic oxygen compounds | ||||||
| Glucose | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Glucose decrease (36 hours) | |||||
| Induced Change | PIGF protein expression levels: decrease | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Healthy individual | |||||
| Details | It is reported that glucose decrease causes the decrease of PIGF protein expression compared with control group. | |||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.

