Details of Protein
General Information of Protein (ID: PRT00880) | |||||
---|---|---|---|---|---|
Name | Glucose-6-phosphatase catalytic 1 (G6PC1) | ||||
Synonyms |
Click to Show/Hide Synonyms of This Protein
Glucose-6-phosphatase; G-6-Pase; G6Pase; G6pc1; G6pc; G6pt
|
||||
Gene Name | G6pc1 | Gene ID | |||
UniProt ID | |||||
Family | Hydrolases (EC 3) | ||||
EC Number | EC: 3.1.3.9 (Click to Show/Hide the Complete EC Tree) | ||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
Sequence |
MEEGMNILHDFGIQSTRYLQVNYQDSQDWFILVSVIADLRNAFYVLFPIWFHLKETVGIN
LLWVAVVGDWFNLVFKWILFGQRPYWWVLDTDYYSNSSVPIIKQFPVTCETGPGSPSGHA MGAAGVYYVMVTSTLAIFRGKKKPTYGFRCLNVILWLGFWAVQLNVCLSRIYLAAHFPHQ VVAGVLSGIAVAETFSHIRGIYNASLRKYCLITIFLFGFALGFYLLLKGLGVDLLWTLEK AKRWCERPEWVHLDTTPFASLFKNLGTLLGLGLALNSSMYRKSCKGELSKLLPFRFACIV ASLVLLHLFDSLKPPSQVELIFYILSFCKSATVPFASVSLIPYCLARILGQTHKKSL |
||||
Function | Hydrolyzes glucose-6-phosphate to glucose in the endoplasmic reticulum. Forms with the glucose-6-phosphate transporter (SLC37A4/G6PT) the complex responsible for glucose production in the terminal step of glycogenolysis and gluconeogenesis. Hence, it is the key enzyme in homeostatic regulation of blood glucose levels. | ||||
Regulatory Network | |||||
Full List of Metabolite(s) Regulating This Protein | ||||||
---|---|---|---|---|---|---|
Nucleosides, nucleotides, and analogues | ||||||
AICAR | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
Detailed Information |
Metabo Info
![]() |
|||||
Regulating Pair |
Experim Info
![]() |
[1] | ||||
Introduced Variation | AICAR addition (24 hours) | |||||
Induced Change | G6PC1 mRNA levels: increase (FC = 4.35) | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Obesity [ICD-11: 5B81] | |||||
Details | It is reported that AICAR addition causes the increase of G6PC1 mRNA levels compared with control group. | |||||
References | |||||
---|---|---|---|---|---|
1 | Identification and characterization of a small molecule AMPK activator that treats key components of type 2 diabetes and the metabolic syndrome. Cell Metab. 2006 Jun;3(6):403-16. |
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.