Details of Protein
| General Information of Protein (ID: PRT00873) | |||||
|---|---|---|---|---|---|
| Name | Fatty acid desaturase 3 (FADS3) | ||||
| Synonyms |
Click to Show/Hide Synonyms of This Protein
Delta(13) fatty acid desaturase; Delta(13) desaturase; MNCb-0629; Fads3
|
||||
| Gene Name | Fads3 | Gene ID | |||
| UniProt ID | |||||
| Family | Oxidoreductases (EC 1) | ||||
| EC Number | EC: 1.14.19.- (Click to Show/Hide the Complete EC Tree) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
| Sequence |
MGGVGEPGGGPGPREGPAPLGAPLPIFRWEQIRQHDLPGDKWLVIERRVYDISRWAQRHP
GGSRLIGHHGAEDATDAFHAFHQDLHFVRKFLKPLLIGELAPEEPSQDGAQNAQLIEDFR ALRQAAEDMKLFEADTTFFALLLGHILAMELLAWLIIYLLGPGWVSSILAALILAISQAQ CWCLQHDLGHASIFTKSRWNHVAQQFVMGQLKGFSAHWWNFRHFQHHAKPNIFHKDPDVT VAPVFLLGESSVEYGKKKRRYLPYNHQHLYFFLIGPPLLTLVNFEVENLAYMLVCMQWTD LLWAASFYSRFFLSYSPFYGATGTLLLFVAVRVLESHWFVWITQMNHIPKEIGHEKHRDW ASSQLAATCNVEPSLFIDWFSGHLNFQIEHHLFPTMPRHNYRRVAPLVKAFCAKHGLHYE VKPFLTALVDIIGSLKKSGDIWLDAYLHQ |
||||
| Function | Mammals have different sphingoid bases that differ in their length and/or pattern of desaturation and hydroxyl groups. The predominant sphingoid base in mammalian ceramides is sphing-4-enine (sphingosine or SPH) which has a trans desaturation at carbon 4. FADS3 is a ceramide desaturase that introduces a cis double bond between carbon 14 and carbon 15 of the SPH-containing ceramides, producing sphinga-4,14-dienine-containing ceramides (SPD ceramides). SPD ceramides occur widely in mammalian tissues and cells. Due to their unusual structure containing a cis double bond, SPD ceramides may have an opposite, negative role in lipid microdomain formation relative to conventional ceramides. FADS3 also acts as a methyl-end fatty acyl coenzyme A (CoA) desaturase that introduces a cis double bond between the preexisting double bond and the terminal methyl group of the fatty acyl chain. Desaturates (11E)-octadecenoate (trans-vaccenoate, the predominant trans fatty acid in human milk) at carbon 13 to generate (11E,13Z)-octadecadienoate (also known as conjugated linoleic acid 11E,13Z-CLA). | ||||
| Regulatory Network | |||||
| Full List of Metabolite(s) Regulating This Protein | ||||||
|---|---|---|---|---|---|---|
| Organic oxygen compounds | ||||||
| Glucose | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
 click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Glucose (low concentration) addition (17.50 hours) | |||||
| Induced Change | FADS3 protein abundance levels: increase (FC = 1.99) | |||||
| Summary | Introduced Variation
Induced Change
|
|||||
| Disease Status | Cerebral stroke [ICD-11: 8B11] | |||||
| Details | It is reported that low glucose addition causes the increase of FADS3 protein abundance compared with control group. | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | Quantitative Proteomics Reveals the Beneficial Effects of Low Glucose on Neuronal Cell Survival in an in vitro Ischemic Penumbral Model. Front Cell Neurosci. 2020 Sep 1;14:272. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.