Details of Protein
| General Information of Protein (ID: PRT00866) | |||||
|---|---|---|---|---|---|
| Name | Cytochrome C oxidase polypeptide VIa (COX6A2) | ||||
| Synonyms |
Click to Show/Hide Synonyms of This Protein
Cytochrome c oxidase subunit 6A2, mitochondrial; COXVIAH; Fragment; Cox6a2
|
||||
| Gene Name | Cox6a2 | Gene ID | |||
| UniProt ID | |||||
| Family | Cytochrome oxidase (CytOx) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
| Sequence |
PLKVLSRSMASASKGDHGGAGANTWRLLTFVLALPSVALCSLNCWMHAGHHERPEFIPYH
HLRIRTKPFSWGDGNHTLFHNPHVNPLPTGYEQP |
||||
| Function | Component of the cytochrome c oxidase, the last enzyme in the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII) and cytochrome c oxidase (complex IV, CIV), that cooperate to transfer electrons derived from NADH and succinate to molecular oxygen, creating an electrochemical gradient over the inner membrane that drives transmembrane transport and the ATP synthase. Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Electrons originating from reduced cytochrome c in the intermembrane space (IMS) are transferred via the dinuclear copper A center (CU(A)) of subunit 2 and heme A of subunit 1 to the active site in subunit 1, a binuclear center (BNC) formed by heme A3 and copper B (CU(B)). The BNC reduces molecular oxygen to 2 water molecules unsing 4 electrons from cytochrome c in the IMS and 4 protons from the mitochondrial matrix. Plays a role in the assembly and stabilization of complex IV. | ||||
| Regulatory Network | |||||
| Full List of Metabolite(s) Regulating This Protein | ||||||
|---|---|---|---|---|---|---|
| Organic acids and derivatives | ||||||
| Leucine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
 click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Leucine addition (72 hours) | |||||
| Induced Change | COX6A2 mRNAlevel levels: decrease | |||||
| Summary | Introduced Variation
Induced Change
|
|||||
| Disease Status | Type 2 diabetes mellitus [ICD-11: 5A11] | |||||
| Details | It is reported that leucine addition causes the decrease of COX6A2 mRNA levels compared with control group. | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | Chronic exposure to leucine in vitro induces -cell dysfunction in INS-1E cells and mouse islets. J Endocrinol. 2012 Oct;215(1):79-88. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.