Details of Protein

General Information of Protein (ID: PRT00852)
Name	GTP/GDP carrier protein 1 (GGC1)
Synonyms	Click to Show/Hide Synonyms of This Protein YDL198C; D1214; GGC1; SHM1; YHM1
Gene Name	GGC1	Gene ID	851329
UniProt ID	P38988
Family	Mitochondrial carrier (MC)
TC Number	TC: 2.A.29.21.1 (Click to Show/Hide the Complete TC Tree) The Mitochondrial Carrier (MC) Family . TC: 2.A.29.21.1
	*Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein*
Sequence	MPHTDKKQSGLARLLGSASAGIMEIAVFHPVDTISKRLMSNHTKITSGQELNRVIFRDHF SEPLGKRLFTLFPGLGYAASYKVLQRVYKYGGQPFANEFLNKHYKKDFDNLFGEKTGKAM RSAAAGSLIGIGEIVLLPLDVLKIKRQTNPESFKGRGFIKILRDEGLFNLYRGWGWTAAR NAPGSFALFGGNAFAKEYILGLKDYSQATWSQNFISSIVGACSSLIVSAPLDVIKTRIQN RNFDNPESGLRIVKNTLKNEGVTAFFKGLTPKLLTTGPKLVFSFALAQSLIPRFDNLLSK
Function	Mitochondrial GTP/GDP transporter required for GTP uptake and GDP exit from mitochondria. Involved in mitochondrial iron transport and essential for mitochondrial genome maintenance.
Regulatory Network
Regulatory Network

Full List of Metabolite(s) Regulating This Protein
Homogeneous non-metal compounds
Nitrogen		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Nitrogen limitation (1.50 hours)
Induced Change	GGC1 protein expression levels: increase
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that nitrogen limitation causes the increase of GGC1 protein expression compared with control group.

References
1	Proteome analysis of yeast response to various nutrient limitations. Mol Syst Biol. 2006;2:2006.0026.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.