Details of Protein

General Information of Protein (ID: PRT00851)
Name Solute carrier family 25 member 21 (SLC25A21)
Synonyms   Click to Show/Hide Synonyms of This Protein
Mitochondrial 2-oxodicarboxylate carrier; SLC25A21; ODC
Gene Name SLC25A21 Gene ID
89874
UniProt ID
Q9BQT8
Family Mitochondrial carrier (MC)
TC Number   TC: 2.A.29.2.4  (Click to Show/Hide the Complete TC Tree)
The Mitochondrial Carrier (MC) Family
.
TC: 2.A.29.2.4
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MSAKPEVSLVREASRQIVAGGSAGLVEICLMHPLDVVKTRFQIQRCATDPNSYKSLVDSF
RMIFQMEGLFGFYKGILPPILAETPKRAVKFFTFEQYKKLLGYVSLSPALTFAIAGLGSG
LTEAIVVNPFEVVKVGLQANRNTFAEQPSTVGYARQIIKKEGWGLQGLNKGLTATLGRHG
VFNMVYFGFYYNVKNMIPVNKDPILEFWRKFGIGLLSGTIASVINIPFDVAKSRIQGPQP
VPGEIKYRTCFKTMATVYQEEGILALYKGLLPKIMRLGPGGAVMLLVYEYTYSWLQENW
Function Transports C5-C7 oxodicarboxylates across the inner membranes of mitochondria. Can transport 2-oxoadipate, 2-oxoglutarate, adipate, glutarate, and to a lesser extent, pimelate, 2-oxopimelate, 2-aminoadipate, oxaloacetate, and citrate.
Regulatory Network
Full List of Metabolite(s) Regulated by This Protein
      Organic acids and derivatives
            Oxoglutaric acid Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Mutation (Lys232Arg) of SLC25A21
                      Induced Change Oxoglutaric acid concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Muscular atrophy [ICD-11: 8B61]
                      Details It is reported that mutation (Lys232Arg) of SLC25A21 leads to the decrease of oxoglutaric acid levels compared with control group.
References
1 Mitochondrial oxodicarboxylate carrier deficiency is associated with mitochondrial DNA depletion and spinal muscular atrophy-like disease. Genet Med. 2018 Oct;20(10):1224-1235.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.