Details of Protein
General Information of Protein (ID: PRT00840) | |||||
---|---|---|---|---|---|
Name | Alpha-enolase (ENO1) | ||||
Synonyms |
Click to Show/Hide Synonyms of This Protein
2-phospho-D-glycerate hydro-lyase; Enolase 1; Non-neural enolase; NNE; Eno1; Eno-1
|
||||
Gene Name | Eno1 | Gene ID | |||
UniProt ID | |||||
Family | Lyases (EC 4) | ||||
EC Number | EC: 4.2.1.11 (Click to Show/Hide the Complete EC Tree) | ||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
Sequence |
MSILRIHAREIFDSRGNPTVEVDLYTAKGLFRAAVPSGASTGIYEALELRDNDKTRFMGK
GVSQAVEHINKTIAPALVSKKVNVVEQEKIDKLMIEMDGTENKSKFGANAILGVSLAVCK AGAVEKGVPLYRHIADLAGNPEVILPVPAFNVINGGSHAGNKLAMQEFMILPVGASSFRE AMRIGAEVYHNLKNVIKEKYGKDATNVGDEGGFAPNILENKEALELLKTAIAKAGYTDQV VIGMDVAASEFYRSGKYDLDFKSPDDPSRYITPDQLADLYKSFVQNYPVVSIEDPFDQDD WGAWQKFTASAGIQVVGDDLTVTNPKRIAKAASEKSCNCLLLKVNQIGSVTESLQACKLA QSNGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQILRIEEELGSK AKFAGRSFRNPLAK |
||||
Function | Glycolytic enzyme the catalyzes the conversion of 2-phosphoglycerate to phosphoenolpyruvate. In addition to glycolysis, involved in various processes such as growth control, hypoxia tolerance and allergic responses. May also function in the intravascular and pericellular fibrinolytic system due to its ability to serve as a receptor and activator of plasminogen on the cell surface of several cell-types such as leukocytes and neurons. Stimulates immunoglobulin production. | ||||
Regulatory Network | |||||
Full List of Metabolite(s) Regulating This Protein | ||||||
---|---|---|---|---|---|---|
Organic acids and derivatives | ||||||
Methionine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
Detailed Information |
Metabo Info
![]() |
|||||
Regulating Pair |
Experim Info
![]() |
[1] | ||||
Introduced Variation | Methionine addition (5 hours) | |||||
Induced Change | ENO1 protein expression levels: increase | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Hyperhomocysteinaemia [ICD-11: 3B61] | |||||
Details | It is reported that methionine addition causes the increase of ENO1 protein expression compared with control group. | |||||
References | |||||
---|---|---|---|---|---|
1 | Regulatory cross-talk of mouse liver polyamine and methionine metabolic pathways: a systemic approach to its physiopathological consequences. Amino Acids. 2012 Feb;42(2-3):577-95. |
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.