Details of Protein
General Information of Protein (ID: PRT00837) | |||||
---|---|---|---|---|---|
Name | Glucose-6-phosphate 1-dehydrogenase X (G6PDX) | ||||
Synonyms |
Click to Show/Hide Synonyms of This Protein
G6PD; G6pdx; G6pd; G6pd-1
|
||||
Gene Name | G6pdx | Gene ID | |||
UniProt ID | |||||
Family | Oxidoreductases (EC 1) | ||||
EC Number | EC: 1.1.1.49 (Click to Show/Hide the Complete EC Tree) | ||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
Sequence |
MAEQVALSRTQVCGILREELYQGDAFHQADTHIFIIMGASGDLAKKKIYPTIWWLFRDGL
LPEDTFIVGYARSRLTVDDIRKQSEPFFKATPEERPKLEEFFARNSYVAGQYDDAASYKH LNSHMNALHQGMQANRLFYLALPPTVYEAVTKNIQETCMSQTGWNRIIVEKPFGRDLQSS NQLSNHISSLFREDQIYRIDHYLGKEMVQNLMVLRFANRIFGPIWNRDNIACVILTFKEP FGTEGRGGYFDEFGIIRDVMQNHLLQMLCLVAMEKPATTGSDDVRDEKVKVLKCISEVET DNVVLGQYVGNPNGEGEAANGYLDDPTVPHGSTTATFAAAVLYVENERWDGVPFILRCGK ALNERKAEVRLQFRDVAGDIFHQQCKRNELVIRVQPNEAVYTKMMTKKPGMFFNPEESEL DLTYGNRYKNVKLPDAYERLILDVFCGSQMHFVRSDELREAWRIFTPLLHKIDREKPQPI PYVYGSRGPTEADELMKRVGFQYEGTYKWVNPHKL |
||||
Function | Catalyzes the rate-limiting step of the oxidative pentose-phosphate pathway, which represents a route for the dissimilation of carbohydrates besides glycolysis. The main function of this enzyme is to provide reducing power (NADPH) and pentose phosphates for fatty acid and nucleic acid synthesis. | ||||
Regulatory Network | |||||
Full List of Metabolite(s) Regulated by This Protein | ||||||
---|---|---|---|---|---|---|
Organic acids and derivatives | ||||||
Glutathione | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
Detailed Information |
Metabo Info
![]() |
|||||
Regulating Pair |
Experim Info
![]() |
[1] | ||||
Introduced Variation | Knockdown (siRNA) of G6pdx | |||||
Induced Change | Glutathione concentration: decrease | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Healthy individual | |||||
Details | It is reported that knockdown of G6pdx leads to the decrease of glutathione levels compared with control group. | |||||
References | |||||
---|---|---|---|---|---|
1 | Glucose metabolism during in vitro maturation of mouse oocytes: An study using RNA interference. J Cell Physiol. 2018 Sep;233(9):6952-6964. |
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.