Details of Protein

General Information of Protein (ID: PRT00827)
Name Alanine/cysteine transporter 2 (SLC1A5)
Synonyms   Click to Show/Hide Synonyms of This Protein
ATB(0); Baboon M7 virus receptor; RD114/simian type D retrovirus receptor; Sodium-dependent neutral amino acid transporter type 2; Solute carrier family 1 member 5; SLC1A5; ASCT2; M7V1; RDR; RDRC
Gene Name SLC1A5 Gene ID
6510
UniProt ID
Q15758
Family Dicarboxylate/amino acid:cation symporter (DAACS)
TC Number   TC: 2.A.23.3.3  (Click to Show/Hide the Complete TC Tree)
The Dicarboxylate/Amino Acid:Cation (Na+ or H+) Symporter (DAACS) Family
.
TC: 2.A.23.3.3
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MVADPPRDSKGLAAAEPTANGGLALASIEDQGAAAGGYCGSRDQVRRCLRANLLVLLTVV
AVVAGVALGLGVSGAGGALALGPERLSAFVFPGELLLRLLRMIILPLVVCSLIGGAASLD
PGALGRLGAWALLFFLVTTLLASALGVGLALALQPGAASAAINASVGAAGSAENAPSKEV
LDSFLDLARNIFPSNLVSAAFRSYSTTYEERNITGTRVKVPVGQEVEGMNILGLVVFAIV
FGVALRKLGPEGELLIRFFNSFNEATMVLVSWIMWYAPVGIMFLVAGKIVEMEDVGLLFA
RLGKYILCCLLGHAIHGLLVLPLIYFLFTRKNPYRFLWGIVTPLATAFGTSSSSATLPLM
MKCVEENNGVAKHISRFILPIGATVNMDGAALFQCVAAVFIAQLSQQSLDFVKIITILVT
ATASSVGAAGIPAGGVLTLAIILEAVNLPVDHISLILAVDWLVDRSCTVLNVEGDALGAG
LLQNYVDRTESRSTEPELIQVKSELPLDPLPVPTEEGNPLLKHYRGPAGDATVASEKESV
M
Structure
5LLM ; 5LLU ; 5LM4 ; 5MJU ; 6GCT ; 6MP6 ; 6MPB ; 6RVX ; 6RVY
Function Sodium-dependent amino acids transporter that has a broad substrate specificity, with a preference for zwitterionic amino acids. It accepts as substrates all neutral amino acids, including glutamine, asparagine, and branched-chain and aromatic amino acids, and excludes methylated, anionic, and cationic amino acids. Through binding of the fusogenic protein syncytin-1/ERVW-1 may mediate trophoblasts syncytialization, the spontaneous fusion of their plasma membranes, an essential process in placental development.; (Microbial infection) Acts as a cell surface receptor for Feline endogenous virus RD114.; (Microbial infection) Acts as a cell surface receptor for Baboon M7 endogenous virus.; (Microbial infection) Acts as a cell surface receptor for type D simian retroviruses.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Organic acids and derivatives
            Lactic acid Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Lactic acid addition (6 hours)
                      Induced Change SLC1A5 protein expression levels: increase (FC = 1.6)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Cervical Cancer [ICD-11: 2C77]
                      Details It is reported that lactic acid addition causes the increase of SLC1A5 protein expression compared with control group.
References
1 Lactate promotes glutamine uptake and metabolism in oxidative cancer cells. Cell Cycle. 2016;15(1):72-83.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.